KEGG   Accumulibacter phosphatis: CAP2UW1_2048Help
Entry
CAP2UW1_2048      CDS       T00966                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
app  Accumulibacter phosphatis
Pathway
app00260  Glycine, serine and threonine metabolism
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01120  Microbial metabolism in diverse environments
app01130  Biosynthesis of antibiotics
app01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAP2UW1_2048
Enzymes [BR:app01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CAP2UW1_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 HTH_31
Motif
Other DBs
NCBI-ProteinID: ACV35344
UniProt: C7RMX7
Position
2303727..2304758
Genome map
AA seq 343 aa AA seqDB search
MQHFASDNYAGICPEALAALLAANDGHVRSYGDDEWTLQAADRLRELFETDCDVYFVFNG
TAANSLALAALCQSYHSVICHHLAHVETDECGAPEFFSNGAKLLAVGGEQGKLTPAAIVE
AVSRRSDIHHPKPKVVTLTQATEVGTVYRPDELRALADAAHERGLRVHMDGARFANAVAG
LGLSPAEMTWRAGVDVLCFGGTKMGLPVGEAVVFFDRRLAEDFSYRCKQAGQLASKMRFL
SAPWLGILENGTWLRHAAHANAMARRLAAGVAEVAGLPALFPVDANGVFVRLPGRIEEGL
RERGWLFYNFIGAGGARFMCGWDTAPETVDRLVGDVRELARES
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatttcgcgagtgacaactacgccggcatctgcccggaagcgctggcggccctg
ctcgccgccaatgatggacacgtccgctcgtatggcgacgacgaatggacgctgcaggcg
gctgatcgcctgcgcgagctcttcgagaccgactgcgacgtctatttcgtcttcaacggc
acggccgccaattcgctcgcgctcgccgcgctctgccagtcgtaccacagcgtcatctgt
caccatctggcgcacgtggagaccgacgaatgcggcgccccggagttcttctcgaatggc
gccaagctgctggccgtgggtggcgagcaaggcaagctgacgccggcggcgatcgtcgaa
gccgttagccggcgcagcgacatccaccatccaaagccgaaggtggtgacgctgacgcaa
gcgacggaagtgggtacggtgtaccgcccggacgaattgcgagcccttgccgacgcggcg
cacgaacggggcctgcgcgttcacatggatggcgcccgcttcgccaatgcggtcgccgga
ctcggcctgagcccggccgaaatgacctggcgggcaggtgtcgatgtgctgtgcttcggc
ggcaccaagatgggcttgccggtcggcgaggcggtcgtcttcttcgaccgtcggctggcc
gaggacttttcctatcgctgcaaacaggcgggccaactggcctcgaagatgcgcttcctg
tcggcaccgtggctggggattctcgaaaacggcacctggttgcggcacgcggcgcacgcc
aacgccatggcgcggcgcctggccgcgggagtggcggaagtcgccggcctgccggcgctt
ttcccggtcgatgccaacggtgtcttcgtgcgtctaccgggtcggatcgaggaagggctg
cgcgagcgtggctggttgttctacaacttcatcggtgccggcggagcacgtttcatgtgc
ggctgggacacggcgccggagaccgtcgatcgcctcgttggcgacgttcgcgagctggcg
cgcgagtcgtga

DBGET integrated database retrieval system