KEGG   Accumulibacter phosphatis: CAP2UW1_2870Help
Entry
CAP2UW1_2870      CDS       T00966                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
app  Accumulibacter phosphatis
Pathway
app00900  Terpenoid backbone biosynthesis
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CAP2UW1_2870
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CAP2UW1_2870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C AIRC
Motif
Other DBs
NCBI-ProteinID: ACV36150
UniProt: C7RTY6
Position
complement(3321346..3322551)
Genome map
AA seq 401 aa AA seqDB search
MSCPAAVQQLTILGSTGSIGVSTLDVVRRHRHRYRVVALCAHRQVDRLFEQCVEFQPQHA
VVGDARLAADLAARLAGAGCPTEVTHGAEALVRMAQLPEVDSVMAAIVGAAGLPPTLAAA
VAGKKILLANKEALVMAGSVFMRAVRENGATLLPIDSEHNAIFQSLPSGYSGDPAESGVL
GLFLTASGGPFRTMAPADLESVTPEQACAHPNWVMGRKISVDSSTMMNKGLEVIEAHWLF
NIPAERIQVVIHPESVIHSLVQYADGSVIAELGNPDMRTPIAHALAYPRRIAAGVAPLDL
CTIGSLHFERPDLGRLPCLALAYRALRDGGSAPTTLNAANEVAVQAFLDGRIGFPAIPRV
IAGVMDGLPAGKALGSLSEVLTADRLAREAAEQWLVQVARQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgccccgcggctgtgcagcaactcaccatcctggggtccaccggctcgatcgga
gtcagtacgctcgatgtcgttcgccggcaccggcatcgttatcgcgtcgtcgctctctgc
gcgcatcgacaggtggatcgcctcttcgagcagtgcgtcgagttccagccgcagcatgcc
gtcgtcggcgacgcccgcttggctgccgatctcgccgcgcgcttggcgggcgccggatgc
ccgaccgaggtgacgcacggcgccgaggcgctggtgcgtatggcacaactaccggaggtc
gattcggtgatggcggcgatcgtcggcgcggcgggcttgccgcccactctggctgctgcc
gtggccggcaagaagattctgctggcgaacaaggaagcgctggtcatggccggctcggtt
ttcatgcgcgccgtgcgcgagaatggggcgacgctgttgccgatcgacagcgaacacaac
gccatctttcaatcgctgccaagcggctactccggggatccggccgaaagcggcgtgctt
ggcttgtttctcaccgcctctggcggtccgtttcgcaccatggcgccggccgatctcgag
tcggtcacccccgaacaggcctgcgcccaccccaactgggtcatgggccgaaaaatctcg
gtcgattcgtcgaccatgatgaacaaggggctcgaagtcatcgaggcacactggctgttc
aacattcccgccgagcgaattcaggtggtcatccacccggagagcgtcattcactcgctc
gttcagtacgccgatggctcggtgatcgccgaactcggcaacccggacatgcgtacgccg
attgcgcatgctctcgcctatccgcggcggattgccgccggggtcgcgcctctggatctg
tgcacgatcgggtcactgcatttcgaacggccggacctcggccgccttccgtgcctggct
ttggcgtatcgggcgctgcgtgacggtggcagcgcaccgacgacgctgaatgccgccaac
gaagttgccgtacaggcttttctcgacggcagaatcggcttcccggcgattccccgcgtc
attgccggcgtcatggacggcctgccggcgggcaaggcgctcggctcgttgtccgaggtc
ctgacggcagaccggctggcccgcgaggccgccgagcagtggcttgtgcaggtggcgcgg
cagtga

DBGET integrated database retrieval system