KEGG   Accumulibacter phosphatis: CAP2UW1_2878Help
Entry
CAP2UW1_2878      CDS       T00966                                 

Definition
(GenBank) UTP-GlnB uridylyltransferase, GlnD
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
app  Accumulibacter phosphatis
Pathway
app02020  Two-component system
Brite
KEGG Orthology (KO) [BR:app00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CAP2UW1_2878
Enzymes [BR:app01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     CAP2UW1_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase ACT HD NTP_transf_2 ACT_4 ACT_6 DUF294
Motif
Other DBs
NCBI-ProteinID: ACV36158
UniProt: C7RTZ4
Position
3328443..3331031
Genome map
AA seq 862 aa AA seqDB search
MASVAVVSEPLVGRCRSRLRDAQKSIRERFLAEGDAPCLLHERCQLIDAVLGDLWRELDL
PTSLALVAVGGYGRGELYPASDVDLMLLLPGPPDEALTAQLEAVVTVFYDIGLEVAPSVR
TIDECSQAASGDLTVQTALLEARLLAGNARLFEDLSAELARILDPHAFFEAKKKEQEERY
LRYYGSPYSLEPNCKEAPGGLRDLQTILWIARAAGYGETWQALAQHGFITREEEQQLQRS
VSFLQQLRTRLHIHVGRREDRLLFDYQSALAEQWGYKATATRRASELLMQQYYRTAKEVT
QINTILLLNIGAAISPLPDQPPQAINEHFQNTHDLLDVVDEGVFAREPGVILEAFLVMQQ
HPELQGMTARTLRALWHARTLIDDGFRRDPDNRARFLQILQQPRGVLHELQRMNQFGVLG
RYLPKFGKIVGQMQHDLFHVYTVDQHTLQVLRNLRRFLADEFTHEYPLCSELIRDFPRAW
VLYVAALFHDIAKGRGGDHSELGAIDAAAFCADHGLDAEDSELVVWLVQRHLLMSMVAQK
QDFADPDVLGGFATMAKDERHLTALYLFTVADIRGTSPKVWNTWKGQLLEQLFRSTCRTL
LAGGHVPVRQGLIEERQQEALRLLRYFALPEAVHQRLWKQLDTVYFLRHSAEEIAWHTRA
LHYRPGVEKPVVKARVNPQGEGLEVMIYTRDQRDLFARVVGFFGRAGYTIVDAKIHTTRH
GYALDSFMLLDLSDRDSDRAMITYIEHELSTRLSRQSPPEAPASGRISRQVKHFPIQPVV
TIEPDEKGSHYVLSVNAADRPGLLYTIAMTLAAHGANLHTAKISTLGERVEDTFLISGGD
LGQAASRIRLETELLDRLSLKL
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggttgccgtcgttagtgaaccactggtcggccgctgccgatcacgcctgcgg
gacgcccagaagagcatccgcgagcgctttctggccgagggcgatgcaccgtgcctgttg
cacgaacgctgccaactgatcgacgcggtcctcggcgacctgtggcgcgaactggacttg
ccgacgtcattggcgctggtcgctgtcggcggttatgggcgcggcgaactctatccggca
tcggacgtggacctgatgctgctgctgcccggcccgcctgacgaggcactgacagcgcag
ctcgaggcggtcgtcaccgtcttctacgacatcggactggaggtcgcgccgagcgtgcgc
acgatcgacgagtgttcgcaggcagcaagcggtgatctgactgttcaaaccgcgctgctc
gaagcccgcctgctcgctggaaacgccaggctgttcgaggatctttcggcggaactggcc
cgaatcctcgacccgcacgccttcttcgaagcgaagaagaaagagcaggaggagcgctac
ctgcgctattacggctcgccgtacagcctggagcccaattgcaaggaggctcccggcggc
ctgcgcgacctgcagacaatcctctggatcgcccgtgcagcaggctatggggaaacctgg
caagcgctggcgcagcacggattcatcacccgggaggaggaacagcaactccagcgcagc
gtgagtttcctgcagcagttgcgaacccgcctgcacattcatgtcggcaggcgtgaggat
cgcctcctctttgactaccagagtgcgcttgccgagcagtggggctacaaggcgacggca
acccggcgggccagcgaactgttgatgcagcagtattaccgcacggccaaggaagtcacg
cagatcaacacgatcctgctgctgaacatcggcgccgccatctcgccgctgcccgaccag
ccgccgcaagccatcaatgaacacttccagaatacgcacgacctgctggatgtcgtcgac
gaaggggttttcgcgagagagcccggggtcatcctggaggcttttctcgtcatgcaacag
catcccgagttgcaggggatgacggcacgcaccctgcgcgcgctgtggcacgcacgcacc
ctgatcgatgatggtttccgccgtgaccccgacaatcgtgcccgcttcctgcaaatcctc
cagcaaccgcgtggcgtgctgcatgaactccagcgtatgaaccagttcggcgttcttggc
cgctatctacccaagttcggcaagatcgtcggccagatgcagcacgacctgtttcatgtc
tatacggtcgaccagcatactctgcaggtcctgcgtaacctgcgtcgttttctcgccgac
gagttcacccacgagtacccgctgtgcagcgaactgatcagagactttccccgcgcctgg
gtcctctacgtcgccgcccttttccacgacattgccaagggacgaggcggtgatcattcg
gaactcggtgccatcgacgccgccgcgttctgtgccgatcatggcctcgacgcggaggac
agcgaactggtcgtttggctcgtccagcggcatctgctgatgtcgatggtcgcgcagaag
caggactttgccgaccccgacgtcctcggtggctttgccacgatggccaaggacgagcgg
cacctgaccgcgctctatctgttcacggtcgccgacattcgtggcaccagcccgaaggtc
tggaacacctggaaaggacagctcctcgagcagcttttccggagcacgtgccgaacattg
ctcgccggcggtcacgtaccggtgcgccagggactgatcgaggagcggcagcaggaagcg
ctgcgcctgctgcgctatttcgccctccccgaggcagtgcatcagcgcttgtggaagcaa
ctcgataccgtctacttcctgcgccattccgcggaggaaatcgcctggcatacgcgcgcg
ctgcactatcggcccggcgtcgagaagccggtggtcaaggcgcgcgtcaacccgcagggc
gaagggctcgaggtgatgatctacacccgcgaccagcgcgacctgttcgcacgcgtggtg
gggtttttcggtcgtgccggctacaccatcgtcgatgccaagatccacaccacgcggcat
ggctacgcgctggacagcttcatgcttctcgacctcagcgaccgcgacagtgaccgcgcc
atgatcacctacatcgagcacgagctgagcacccgcctcagtcgccagagcccacccgag
gcgccggccagcggacgcatctcgcgccaggtcaagcacttcccgattcagcccgtagtc
accatcgaacctgacgagaagggctcgcactacgtgctgtcggtcaacgctgccgatcgc
cccggtctcctctacacgatcgccatgacgctggcagcgcacggtgccaatctgcatacg
gccaagatctcgacgcttggcgaacgggtcgaggacaccttcctgatcagcggcggcgac
ctcggtcaggccgccagccgcatcagactggagaccgaactgttggatcgcttgagcttg
aagctctga

DBGET integrated database retrieval system