KEGG   Accumulibacter phosphatis: CAP2UW1_2911Help
Entry
CAP2UW1_2911      CDS       T00966                                 

Definition
(GenBank) Adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
app  Accumulibacter phosphatis
Pathway
app00230  Purine metabolism
app00250  Alanine, aspartate and glutamate metabolism
app01100  Metabolic pathways
Module
app_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CAP2UW1_2911
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CAP2UW1_2911
Enzymes [BR:app01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CAP2UW1_2911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ACV36190
UniProt: C7RU26
Position
complement(3368187..3369503)
Genome map
AA seq 438 aa AA seqDB search
MTGMAKNVVVVGTQWGDEGKGKIVDWLTDHAKGVVRFQGGHNAGHTLVVGDKVYKLNLVP
SGIVRDGVDCFIGNGVVLDIHHLISEIRVIESGGIDVRSRLKISPGCPIILAYHSALDHA
REAARCADVRIGTTGKGIGPAYEDKVARRALRVYDLFYPARFAEKLKENLDYHNFVLTRY
LGAAAVDCEAVLAQAMADAEEIKPLVTDVSAALHALNKAGHNLLFEGAQGALLDIDHGTY
PFVTSSNCVAGQAAAGSGIGPGMLHYVLGITKAYCTRVGGGPFPSELDIETEGLPGHQMS
QKGREFGTVTGRKRRCGWLDVAALKRSIQINGVTGLCITKLDVLDGLAELKICTGYRLDG
SIVDLLPMGADEVAACEPVLESLPGWSGSTVGATTMAALPLAAQAYLARIEELCDIPIDI
VSTGPERAETVVRRHPLG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaatggctaagaacgtcgtagtcgttggcacccagtggggcgacgagggcaag
ggcaagatcgttgactggctcaccgatcatgcgaagggggtcgtgcgctttcagggcggc
cacaacgccggtcatacgctggtcgtcggcgacaaggtctacaagctcaatctggtgccc
tcggggatcgttcgcgacggggtcgattgcttcatcggcaacggtgtcgtgctcgatatc
catcacctgatcagcgagatccgggtgatcgagtcaggtggcatcgatgtccgctcgcgg
ctcaagatcagcccgggctgtccgatcatcctcgcctaccactctgccctcgatcatgct
cgtgaggctgcgcgctgtgcggacgtcaggatcggcacgaccggcaagggcatcgggccc
gcgtacgaagacaaagtggcgcgccgtgcgctacgcgtttacgacctgttctatcccgcc
cgttttgccgagaagctcaaggagaatctcgactaccacaacttcgtgctgactcgctat
ttgggtgccgcggcagtcgattgcgaagccgtactggcgcaggcgatggccgacgccgag
gagatcaagccgctggtcaccgacgtatcggcagcgctgcatgcgctgaacaaggccggc
cacaatctgctcttcgaaggagctcaaggggcgctgctcgacatcgatcatggcacctat
cccttcgtcacctcatcgaactgcgttgccggtcaggcggccgccggctcgggcatcggt
ccgggcatgctgcactacgtcctgggaatcaccaaggcctattgcacgcgcgttggcggc
gggcctttcccgagcgagctcgatatcgagaccgagggcctgccaggacaccagatgtct
cagaaaggccgggagttcggcaccgtcaccggacgcaaacgtcgctgcggctggctcgat
gtcgcggcgctcaagcgttcgatccagatcaacggggtcactggtctgtgcatcaccaaa
ctcgacgttctcgatggtcttgccgagctgaagatctgtaccggttatcggctcgacggc
agcatcgtcgacctcctgccgatgggcgccgacgaggtcgccgcctgtgagccggtcctc
gagagccttcccggctggtcagggtcgacggttggcgcgactacgatggccgcgctgccg
ctggcggcgcaggcctatttggcgcgcatcgaagaactgtgtgacattccgatcgacatc
gtgtcgaccggaccggagcgcgcggagacggttgtccgtcgtcatccactagggtga

DBGET integrated database retrieval system