KEGG   Accumulibacter phosphatis: CAP2UW1_3189Help
Entry
CAP2UW1_3189      CDS       T00966                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
app  Accumulibacter phosphatis
Pathway
app00071  Fatty acid degradation
app00072  Synthesis and degradation of ketone bodies
app00280  Valine, leucine and isoleucine degradation
app00310  Lysine degradation
app00362  Benzoate degradation
app00380  Tryptophan metabolism
app00620  Pyruvate metabolism
app00630  Glyoxylate and dicarboxylate metabolism
app00640  Propanoate metabolism
app00650  Butanoate metabolism
app00900  Terpenoid backbone biosynthesis
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01120  Microbial metabolism in diverse environments
app01130  Biosynthesis of antibiotics
app01200  Carbon metabolism
app01212  Fatty acid metabolism
app02020  Two-component system
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAP2UW1_3189
   00630 Glyoxylate and dicarboxylate metabolism
    CAP2UW1_3189
   00640 Propanoate metabolism
    CAP2UW1_3189
   00650 Butanoate metabolism
    CAP2UW1_3189
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CAP2UW1_3189
   00072 Synthesis and degradation of ketone bodies
    CAP2UW1_3189
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CAP2UW1_3189
   00310 Lysine degradation
    CAP2UW1_3189
   00380 Tryptophan metabolism
    CAP2UW1_3189
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CAP2UW1_3189
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CAP2UW1_3189
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CAP2UW1_3189
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:app04147]
    CAP2UW1_3189
Enzymes [BR:app01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CAP2UW1_3189
Exosome [BR:app04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAP2UW1_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACV36459
UniProt: C7RVI6
Position
complement(3666400..3667581)
Genome map
AA seq 393 aa AA seqDB search
MSESVVIVGAKRTPVGAFQGQFAGVTAPQLGAVAIKAAVEQAGVKGEDIDEALMGCCLMA
GLRQAPARQAVLGAGLPKSVPCTTLTKMCSSAQKTVMIAHDELLAGSINIAIAGGMESMT
NAPHVLTTARTGYRLGNGVLHDHMFLDGLEDAYEQGKPMGVFAELCVDKYAFSREEMDAY
AVESVTRAQNSVAAGVFKDEIAPVTVSTRKGDVVFDSDETPMKCDASKISKLKPVFKKDG
AVTPANSSSISDGAAAFVLMRESDAKSAGITPLARIVGHSTFAHDPSWFTTAPVFAFQKL
LAKLGWQAEDVDLWEINEAFAAVTMASMRDLKLPADKVNVNGGACALGHPIGATGSRILV
TLLYALKARGLKRGIAGLCAGGGEATAIAIEVL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatccgttgttatcgtcggtgccaagcggacgccggtcggcgccttccagggc
cagttcgcgggtgtgacggcgccgcagctcggcgccgtggcgatcaaggccgctgttgaa
caggcgggtgtcaagggtgaggatatcgacgaagccctgatgggctgctgcctgatggcc
ggcctgcgccaggcccctgcccgccaggcggtgttgggagccgggctgccgaaatcggtg
ccgtgcacgacgctgaccaagatgtgtagctcagcgcagaagacggtgatgatcgcgcat
gacgaactgctggccggttcgatcaacatcgccatcgctggcggcatggagtcgatgacc
aatgcgccgcatgtgctgaccaccgctcgcacgggctatcgcttgggtaatggcgtgctg
catgaccatatgttccttgatggtcttgaggatgcgtatgagcaaggcaagccgatgggc
gtgtttgccgagctatgcgttgacaagtacgctttttcgcgcgaagagatggacgcctac
gccgttgagtcggtaacgcgtgcccagaactccgtcgccgccggggtgttcaaggacgaa
atcgcgccggttaccgtcagcacgcgcaagggtgatgtcgtgtttgattccgacgaaacg
ccgatgaagtgcgatgcgtcgaaaatctccaaactgaagcccgtgttcaagaaggacggc
gccgtgacgccggccaactcgtcgtcgatttccgacggggcggcggcgtttgtcctgatg
cgcgaatctgatgcgaagagcgccggtatcacgccactggcgcggattgtcggacattcc
accttcgcccacgatccgtcgtggtttacaacggcgccggtgttcgctttccagaagctg
cttgccaagctcggctggcaggccgaggatgtcgacctctgggaaatcaacgaggctttt
gcggcggtcacgatggcgtcgatgcgtgacctcaagctgccggccgacaaggtcaacgtc
aatggcggtgcctgcgctcttggccatccgatcggcgccacgggttcgcgcattctggtg
acgttgctctacgccctcaaggcacgtgggctcaagcgcggcatcgccggcctctgcgct
ggtggtggcgaagccaccgcgattgccatcgaagttctctga

DBGET integrated database retrieval system