KEGG   Accumulibacter phosphatis: CAP2UW1_3194Help
Entry
CAP2UW1_3194      CDS       T00966                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
app  Accumulibacter phosphatis
Pathway
app00071  Fatty acid degradation
app00280  Valine, leucine and isoleucine degradation
app00281  Geraniol degradation
app00310  Lysine degradation
app00360  Phenylalanine metabolism
app00362  Benzoate degradation
app00380  Tryptophan metabolism
app00410  beta-Alanine metabolism
app00627  Aminobenzoate degradation
app00640  Propanoate metabolism
app00650  Butanoate metabolism
app00903  Limonene and pinene degradation
app00930  Caprolactam degradation
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01120  Microbial metabolism in diverse environments
app01130  Biosynthesis of antibiotics
app01212  Fatty acid metabolism
Module
app_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CAP2UW1_3194
   00650 Butanoate metabolism
    CAP2UW1_3194
  Lipid metabolism
   00071 Fatty acid degradation
    CAP2UW1_3194
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CAP2UW1_3194
   00310 Lysine degradation
    CAP2UW1_3194
   00360 Phenylalanine metabolism
    CAP2UW1_3194
   00380 Tryptophan metabolism
    CAP2UW1_3194
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CAP2UW1_3194
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CAP2UW1_3194
   00281 Geraniol degradation
    CAP2UW1_3194
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CAP2UW1_3194
   00627 Aminobenzoate degradation
    CAP2UW1_3194
   00930 Caprolactam degradation
    CAP2UW1_3194
Enzymes [BR:app01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CAP2UW1_3194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACV36464
UniProt: C7RVJ1
Position
3675021..3675797
Genome map
AA seq 258 aa AA seqDB search
MTYLNITAEVRGKVGLITLNRPKQLNALNDDLMNEMGCALAGFEADENIGAIVITGSDKA
FAAGADITVMQSLTYMEAYKGDFITRNWEGVKNCRKPVIAAVAGYALGGGCELAMMCDII
LAADNAQFGQPEVRLGILPGAGGTQRLPRAISKAKAMEMCLASRNIDAQEAERAGLVSRV
VPADKLLEEAMSTATRIASFSLPVVMMIKECINRSYESSLSEGLLFERRAFHSAFALEDQ
KEGMAAFVEKRKASFTNR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacttacctcaacatcaccgccgaagtgcgcggcaaggtcggcctgatcaccctcaac
cggccaaagcagctcaatgccctgaacgacgacctgatgaatgaaatgggttgcgcactc
gccggcttcgaggccgacgagaacatcggtgcaatcgtcatcaccggatccgacaaggcc
ttcgccgccggcgccgacatcacggtgatgcagtcactgacctacatggaggcttacaag
ggcgacttcatcacgcgcaactgggaaggcgtcaagaactgccgcaaaccggtgattgcg
gcggtggccggttacgccctcggcggcggctgcgaactggcgatgatgtgcgacatcatc
ctggccgccgacaatgcgcagtttggccaacccgaagtccgcctgggcatcctgcccggt
gccggtggcacccagcgcctgccgcgcgccatctccaaggccaaggcgatggaaatgtgc
ctcgcctcgcgcaacatcgacgctcaggaagccgagcgcgccggcctcgtttcgcgcgtc
gtgccggccgacaaactgctcgaagaggcgatgtccacagccacccgcattgccagcttc
tcgctgccggtggtgatgatgatcaaggaatgcatcaaccggtcctacgagagctcgctg
tccgaaggtctgctgttcgagcgtcgcgctttccactctgccttcgccctcgaggaccag
aaggaaggcatggcggctttcgtcgaaaagcgcaaagcctccttcaccaaccgctga

DBGET integrated database retrieval system