KEGG   Accumulibacter phosphatis: CAP2UW1_3326Help
Entry
CAP2UW1_3326      CDS       T00966                                 

Definition
(GenBank) 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
app  Accumulibacter phosphatis
Pathway
app00540  Lipopolysaccharide biosynthesis
app01100  Metabolic pathways
Module
app_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CAP2UW1_3326
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:app01005]
    CAP2UW1_3326
Enzymes [BR:app01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     CAP2UW1_3326
Lipopolysaccharide biosynthesis proteins [BR:app01005]
 Unusual sugar
  CAP2UW1_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ACV36590
UniProt: C7RIL6
Position
complement(3826071..3826907)
Genome map
AA seq 278 aa AA seqDB search
MKLCHFEAGIDQPLFLIAGPCTAESLDLCLEVAGQMHEICSRLGLPYIFKASYDKANRSS
GRSPRGPGLDAGLQILAEVRRQIGVPVLTDVHREQDIAAVASVVDVLQTPAFLCRQTDFI
EAVAASGKPVNIKKGQFLAPGDMRNVVAKAREAAAGAESIMVCERGASFGYNNLVSDMRS
LAIMRETACPVVFDATHSVQLPGGLGSASGGQREFVPVLARAAVAVGIAGLFMETHPRPE
TALSDGPNSWPLARMEGLLTTLVALDRAVKCAGFEELV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtgccacttcgaggccgggatcgaccagccgttgtttctcatcgccggtcct
tgcacggcagagtctctggatttgtgtctcgaggttgccgggcagatgcacgagatctgt
agtcgcctcggcctgccgtacattttcaaggcctcctacgacaaggccaaccgtagttca
ggccgttcgccgcgcggaccgggccttgacgccggcctgcagatccttgccgaggtgcgc
cgtcagattggcgttccggtgcttaccgacgtgcatcgcgaacaggatatcgctgccgtg
gcgtccgtcgttgacgtgctgcagacgccagcctttctctgtcgtcagaccgacttcatc
gaggccgttgccgcctccggcaagccggtaaacatcaagaaggggcagttcctcgcgccg
ggcgacatgcgcaacgtcgtcgccaaggccagggaggccgcggctggtgccgagtcaatc
atggtttgcgagcgcggtgcatcgtttggctacaacaacctcgtttcggacatgcgcagt
ctggcgatcatgcgcgaaacggcttgtccggtcgtcttcgatgctacgcactcggtgcag
ctacccggtggactggggagcgcatccggcggccagcgcgaattcgttccggtactggcg
cgggctgcggtcgcggtggggattgccgggcttttcatggaaacccatccgcgcccggaa
acggccctgtccgatgggccgaacagctggccactggcgcgaatggaaggtttgttgacg
acgctggtggcgctcgatcgagcggtcaagtgcgctggcttcgaggaactcgtctga

DBGET integrated database retrieval system