KEGG   Accumulibacter phosphatis: CAP2UW1_3339Help
Entry
CAP2UW1_3339      CDS       T00966                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
app  Accumulibacter phosphatis
Pathway
app00790  Folate biosynthesis
app01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAP2UW1_3339
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:app04147]
    CAP2UW1_3339
Enzymes [BR:app01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CAP2UW1_3339
Exosome [BR:app04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAP2UW1_3339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ACV36603
UniProt: C7RIM9
Position
3839710..3840051
Genome map
AA seq 113 aa AA seqDB search
MNTEPSLALEHCRPLRGSQHLLDPGQANALLGSLPGWSIADTGVLRKDFTFPSYAATLLF
VNTVAWLAERQNHHPDLEVGYGRVRVSYSTHDVGGLSRNDFICAAHVEALAGT
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgaaccgtcgcttgccctcgaacactgccgtcccttgcgcggcagccagcac
ttgcttgatccaggccaggcaaatgccctgctcggatcgctacccggctggagcattgcc
gacaccggcgttctccggaaggatttcacctttcccagctatgctgccacgctgctcttc
gtcaacaccgtggcctggctggctgaacgtcagaaccaccatcccgacctggaagtcggc
tacggtcgggtcagggtaagttacagcacgcatgacgtcggcggcctgtcgcgaaacgac
ttcatctgtgctgcccacgtcgaggcactggcaggaacttga

DBGET integrated database retrieval system