KEGG   Accumulibacter phosphatis: CAP2UW1_3404Help
Entry
CAP2UW1_3404      CDS       T00966                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
app  Accumulibacter phosphatis
Pathway
app00040  Pentose and glucuronate interconversions
app00052  Galactose metabolism
app00500  Starch and sucrose metabolism
app00520  Amino sugar and nucleotide sugar metabolism
app01100  Metabolic pathways
app01130  Biosynthesis of antibiotics
Module
app_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CAP2UW1_3404
   00052 Galactose metabolism
    CAP2UW1_3404
   00500 Starch and sucrose metabolism
    CAP2UW1_3404
   00520 Amino sugar and nucleotide sugar metabolism
    CAP2UW1_3404
Enzymes [BR:app01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CAP2UW1_3404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACV36664
UniProt: C7RJ53
Position
3915496..3916413
Genome map
AA seq 305 aa AA seqDB search
MMVRKNVQKAVFPVAGLGTRFLPATKASPKEMLAVVDKPLIQYAVEEAYAAGIREMIFVT
GRHKRAIEDHFDTAYELEAELSAVGNDALIALLHSIKPDDMDCVYVRQPRALGLGHAVLC
AERVVRGEPFALLLADDLMLGEPPIMRQMTDLFAEHQCSILAVQEVPKDQTRRYGIVKGK
AVSSDLVNVEGLIEKPHPSVAPSNLAIAGRYILTPAVFDMIREQPRGSGGEIQLTDGISA
MLATEQVLAYRYHGERYDCGSKLGLMQASVVLAEIHPELGGEFSAWLRERQKIPELRDRR
DRELV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatggtccgaaagaacgttcagaaagcagtcttcccggtcgccggtctcggcacgcgc
ttcctgccggcgaccaaggccagcccgaaggaaatgctggcggtggttgacaagcccctg
attcagtatgctgtcgaggaagcctacgcggctggaattcgggaaatgatcttcgtcact
gggcggcacaagcgcgctatcgaggatcacttcgacacggcctacgaactcgaggccgaa
ctgagcgccgttggcaacgacgcgctgatcgccctgctgcattcgatcaagccggacgat
atggactgtgtgtatgtacgccagccgcgggccctcggcctgggccacgcggtgctatgc
gccgaacgtgtggttcgtggtgaaccctttgcgctgctgctcgccgacgacctgatgctc
ggcgagccgccgatcatgcgccagatgaccgacttgttcgccgagcatcagtgcagcatc
ctggccgttcaggaggtgccgaaggaccagaccaggcgctacgggatcgtcaaggggaag
gccgtgtcgtccgatctggtgaacgtcgagggcctgatcgagaagcctcacccgagcgtc
gccccatcgaatctggcgattgctggccgctatatcctgaccccggcggtttttgacatg
atccgtgagcagccacgcggtagcggtggcgagatccagttgacggacggcatctcggcg
atgctggcgaccgagcaggtactcgcctatcgctatcacggcgagcgctacgactgcggc
agcaagctggggctgatgcaggccagtgttgtcctggcggaaattcaccccgaactcggt
ggcgagttctccgcttggctcagggagcgtcagaagattcctgaactgcgcgatcgcaga
gaccgcgaactcgtttga

DBGET integrated database retrieval system