KEGG   Accumulibacter phosphatis: CAP2UW1_3678Help
Entry
CAP2UW1_3678      CDS       T00966                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
app  Accumulibacter phosphatis
Pathway
app02020  Two-component system
Brite
KEGG Orthology (KO) [BR:app00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CAP2UW1_3678
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    CAP2UW1_3678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACV36931
UniProt: C7RKL1
Position
complement(4204966..4205334)
Genome map
AA seq 122 aa AA seqDB search
MIVAERLLPAVLGLALAGAAAAADPGRGAGLYEARCGACHSLDAHRVGPLHRGVVGRRAG
SAPGYDYSPALAAAAFTWDAALLDAWLKDPEALVPGQRMGYSVADASDRGDLVAFLLSVS
RR
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttgccgagcgactgctgccggcggttctggggttggccctggcgggtgccgcc
gcggccgccgaccccgggcgcggtgccggtctctacgaggcgcgctgcggtgcctgccat
agcctcgatgcccatcgcgtcgggccgctgcaccggggcgtcgtcggtcgccgtgccgga
tcggctcccggatacgactactcaccggcgctggccgctgccgcctttacctgggacgcg
gccctgctcgatgcctggctgaaggatccggaagcactggttcccggccagcgcatgggc
tattcggttgccgatgccagcgaccggggcgacctggtggccttcctgctgtcggtatcg
cggcgctga

DBGET integrated database retrieval system