KEGG   Accumulibacter phosphatis: CAP2UW1_3785Help
Entry
CAP2UW1_3785      CDS       T00966                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
app  Accumulibacter phosphatis
Brite
KEGG Orthology (KO) [BR:app00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CAP2UW1_3785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACV37035
UniProt: C7RL86
Position
complement(4329720..4330982)
Genome map
AA seq 420 aa AA seqDB search
MEIIAQHQTLFLALALACGLYMTWGIGANDVANAMGTTVGSGAITVRQAVVLAATMEFLG
AYLAGGAVADTIAKGIIDGELFRPVPHLLMFGMIAALLATGIWLMVATLRGWPVSSTHTI
VGAVCGVGVAALGVDAVQWEMMAEIVASWLISPVLGGLVSLLLTLSIRRFIFNTRDPVGE
ARKWAPVYAFLVGWIVSLIVVVKGLKHVDITLGNLEGQVLAVAIGVVVAIAARLIMNGVQ
LDARADRAFQYASVERLFIPQMVFTGAAMAFAHGSNDVANGIGPMAAAIQIIETQAVSAT
SPVTPLMLFIGGLGIVAGLATYGYKVMATLGHKITELTPTRAYCATIAAAFVTVAASGLG
LPVSTTHIAVGAVMGVGIARGIGALDLRVVSGIVVSWLVTVPVGAILAAITFHILRASFS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcatcgctcagcatcaaaccctcttcctggcgctggctctcgcctgcggcctt
tacatgacgtgggggatcggcgccaacgatgtcgccaacgccatgggcaccacggtcggc
tccggggctatcacggtcaggcaggctgtcgttctggctgcgacgatggagttcctcggc
gcctatctggcgggcggcgccgtggccgacaccatcgccaagggcatcatcgatggcgag
cttttccgaccggtgccgcatttgctgatgttcggcatgatcgccgcactgctcgccacc
ggcatctggctgatggtcgccacgctgcgtggctggccggtgtcctcgacccatacgatc
gtcggcgccgtgtgcggcgtcggcgttgctgcgctgggtgtggacgcggtgcaatgggaa
atgatggctgagattgtcgccagctggttgatttcgccggtgcttggtggcctcgtgtcg
ctgttgttgacgctgagcattcgccgattcattttcaatacccgcgatccggtcggcgag
gcgcgcaagtgggcgccagtgtatgcctttctggtcggctggatcgtttcgctgatcgtc
gtcgtcaaggggctcaagcacgtcgacatcacactcggcaacctcgaagggcaggtgctc
gccgtggcgatcggtgtcgtcgtcgccatcgccgccaggttgatcatgaacggtgtgcaa
ctcgatgcgcgcgccgaccgagccttccagtacgccagcgtcgagaggctgttcatcccg
cagatggtattcaccggcgcggcgatggccttcgcgcacggctccaacgacgtggccaat
ggcatcggcccaatggcggcggcgattcagatcatcgaaacgcaggcggtgtcggccacc
tcaccggtgacgccgttgatgttgttcatcggcggcctgggcatcgtcgccggtctggcg
acctatggttacaaggtgatggccaccctcggtcacaagatcaccgagctgacgccaacc
cgcgcctactgtgccaccattgccgccgcctttgttaccgtggcggcttccggcttgggt
ctgccggtgtcgactacgcatatcgccgtcggcgccgtgatgggcgtcggcattgcccgc
ggcatcggcgccctggatcttcgtgtcgtcagcggcattgtcgtttcctggctcgtcacc
gttccggttggcgctatcctggcggcgatcaccttccacatcctgcgcgcgtcgttttcc
tag

DBGET integrated database retrieval system