KEGG   Accumulibacter phosphatis: CAP2UW1_4642Help
Entry
CAP2UW1_4642      CDS       T00966                                 

Definition
(GenBank) hypothetical protein
Organism
app  Accumulibacter phosphatis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S26
Motif
Other DBs
NCBI-ProteinID: ACV37772
UniProt: C7RVW2
Position
pAph01:78540..79076
Genome map
AA seq 178 aa AA seqDB search
MNRLLRRLAVGTAIAGAAILALGALAYASGARINSTKSIPVGLYWLSSEPVEKGAYVMFC
PPPIGVFEDARARGYVGAGFCPGGYGYLMKRVLAAKGDAVTISDEGVRVNGELLPHSTPI
RADSNGRPLLRFPAGRFTLDGSELLLMSDVSGTSFDGRYFGPIHRSQIKGVIRAVFTW
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcctgctgcgacgccttgccgtgggtaccgccatcgccggcgccgcgatcctg
gcgctgggtgcgctcgcctatgccagtggtgcccgcatcaacagcaccaagagcatcccg
gttgggctgtactggctgagcagcgagccggtggagaagggcgcttacgtgatgttctgc
ccaccgcccatcggcgtcttcgaggacgccagggccaggggttacgttggggccggcttc
tgtccgggcgggtacggttacctgatgaagcgcgtcctggccgccaaaggcgacgccgtc
accatcagcgatgaaggtgtgcgcgtgaacggcgagctgctgccgcacagtaccccgatc
cgggccgacagcaacggccggcccctgctgcgctttccggccgggcgcttcacgctggac
ggttccgaactgctgctgatgtcggatgtcagcggcacgtccttcgatggccgctacttc
ggcccgatccaccgttcgcagatcaagggcgtgatccgcgctgtttttacctggtaa

DBGET integrated database retrieval system