KEGG   Candidatus Accumulibacter regalis: CAP2UW1_4722
Entry
CAP2UW1_4722      CDS       T00966                                 
Name
(GenBank) hypothetical protein
  KO
K07344  type IV secretion system protein TrbL
Organism
app  Candidatus Accumulibacter regalis
Pathway
app02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:app00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CAP2UW1_4722
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:app02044]
    CAP2UW1_4722
Secretion system [BR:app02044]
 Type IV secretion system
  Trb secretion system protein
   CAP2UW1_4722
SSDB
Motif
Pfam: TrbL LEA_4
Other DBs
NCBI-ProteinID: ACV37845
UniProt: C7RW35
Position
pAph01:complement(153606..155132)
AA seq 508 aa
MSLPTVLKSASITMLLWLAFFSIDAQAAINNAGVLDNVLARYAAAASAWAGVITARASFL
FWTLAVISMVWTFGMLALRKADLGDFYAEFFRFTVFTGFFWWLLTNGPRFATDIMDSLRT
LGGMATGTGATLTPSGIVDIGFDIFFKVLDKSSILSPVDSAVGILISAAILIILALIGVN
MLVLLVSGWILSYAGVFFLGFGGSRWTSDMAIGYYKTVLNIAAQLFTMVLLVGIGKSFVD
QYYAGMDPGISLKELGVMLIVAVVLFALVTKLPSLIGGLAMGGSVHTMGSGLGTGAAMAA
VGMASAAVGVAGAAIATGAASMAGGTQALMAACSKASQDVAGGSDMLASLAGGSSSGAGR
SSAGSGASPLAAAMDSSSAGGGPSGGSSSHSGRSDTRQASAKRGGTPGQAQSGDMASVVA
KVGKVVAGTAANLAQGSWDVAKARAGEVKDAAMDRIGETTGGKIAAAIKARSDQQPAFGS
DSLAKADDQSVDAEAEIAAFRDRAARSS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgagcctgcccaccgtactcaagagcgccagtattacgatgctattgtggctggcgttt
ttctccatcgacgcccaggcagcgatcaacaatgcgggtgtcctcgacaacgtcctggcg
cgctatgcggctgcggccagcgcctgggcaggcgtcatcacggcgcgagccagcttcctg
ttctggacgctcgccgtgatctcgatggtctggaccttcggcatgctggccttgcgcaaa
gctgacctgggtgacttctacgccgagttcttccggttcacggtgttcaccggcttcttc
tggtggttgctcaccaacggcccgcgcttcgctaccgacatcatggattccctacgcacc
ctcggcggcatggccaccgggacaggcgccacgctgaccccgtcgggcattgtcgatatc
ggcttcgacatcttcttcaaggtgctcgacaagtcgtcgatattgtcacccgttgacagt
gcggtcggcatcctcatcagcgctgccatcctcatcatcctggcgttgatcggtgtgaac
atgctggtgctcctggtgagtggctggatcctgtcttacgccggcgtgttcttcctcggc
tttggtgggtcccgctggacctccgacatggcgatcggctactacaagaccgttctgaac
attgccgcgcagctctttaccatggtcctgctggttggcatcggcaaatccttcgtcgac
cagtactacgccgggatggatccgggcatcagcctgaaggaactgggcgtgatgttgatc
gtcgccgtggtgctgtttgcgctcgtgaccaaactgccttcgttgatcggcggcctggcg
atgggtggcagcgtacacaccatgggcagtggcctcggtacgggcgcggcgatggcggcg
gtcggcatggccagtgcggccgtgggtgtcgccggcgcagccattgccaccggggcggcg
agcatggctggcggtactcaagccttgatggcggcgtgctcgaaagcgtcgcaggacgtg
gccggtggtagcgacatgcttgcgagcctggccggcggcagttcgtcgggtgcgggccga
tcgtcggccggtagcggcgcaagcccgctggcggcggcgatggacagcagttcagccggc
ggcgggccgtctggtggcagcagttcacattccggcagatccgacaccaggcaggcgagc
gccaagcggggtggaacgccgggccaagcgcagtcgggcgacatggcttccgtagtggcc
aaggtcgggaaggtcgtcgcaggcactgcggcgaatctggcgcaaggcagctgggacgtc
gcaaaggccagagccggcgaagtgaaggatgccgcgatggatcgcatcggcgagacgacg
ggcggcaagatcgctgcggccatcaaggcgaggagcgaccagcaacccgcattcggcagc
gacagcctggcaaaggcagacgaccaatcggtggacgcagaagcggaaatcgccgcattc
cgtgaccgcgccgcccgatcttcttga

DBGET integrated database retrieval system