KEGG   Candidatus Accumulibacter regalis: CAP2UW1_4723
Entry
CAP2UW1_4723      CDS       T00966                                 
Name
(GenBank) hypothetical protein
Organism
app  Candidatus Accumulibacter regalis
SSDB
Other DBs
NCBI-ProteinID: ACV37846
UniProt: C7RW36
Position
pAph01:complement(155141..155368)
AA seq 75 aa
MITNRPALLTLAALVSSLISACSPETPKKEVPAVNDENCKWENMLKIEDKGTREQFASAC
ARRGPGFTPSPKKEW
NT seq 228 nt   +upstreamnt  +downstreamnt
atgatcaccaaccgccctgccctcctgacgctggcagcccttgtgtcctccttgatcagc
gcctgctcaccagaaacgcccaagaaggaagtgccggccgtgaacgacgaaaactgcaag
tgggaaaacatgctcaagatcgaggacaaggggacgcgcgagcaattcgcctcggcgtgt
gcgcgtcgcggtcccgggttcacacccagtccaaagaaagaatggtga

DBGET integrated database retrieval system