KEGG   Candidatus Accumulibacter regalis: CAP2UW1_4729
Entry
CAP2UW1_4729      CDS       T00966                                 
Name
(GenBank) hypothetical protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
app  Candidatus Accumulibacter regalis
Pathway
app02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:app00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CAP2UW1_4729
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:app02044]
    CAP2UW1_4729
Enzymes [BR:app01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     CAP2UW1_4729
Secretion system [BR:app02044]
 Type IV secretion system
  Trb secretion system protein
   CAP2UW1_4729
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_10 ABC_tran AAA_29 DUF87 T4SS-DNA_transf Zeta_toxin
Other DBs
NCBI-ProteinID: ACV37851
UniProt: C7RW41
Position
pAph01:complement(159802..162360)
AA seq 852 aa
MIAGIAFAIATLGALLLLVLYARIRAVDEELKLKKHRSRDAGLADLLNYAAMVDDGVMVG
KNGAFLAAWLYKGADNASSTDEQREIVSLRINQALSGLGNGWMVHVDAARLPAPNYLDRG
TSHFPDGVSAAIDEERRQLFEGLGTLYEGYYVLTLTWFPALLAQRKFVELMFDDDAKAPD
HKAHTHGLIEFFKRECVSIESRLSSAVELQRLRGHQVVNEDGSAVTHDDFLRWLQFCVTG
VNHPVQLPSNPMYLDALIGGQELWTGVVPKVGRKFIQVVAIEGFPLESTPGMLTALGELA
CEYRWSSRFIFMDTHEAVRHLDKFRKKWRQKIRGFFDQVFNTHLGPIDQDALSMVADAEA
AIAEVNSGLVAQGYYTSVVVLMDEDRSRLEASARQVEKAVNRLGFAARIETLNTMDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSTIWTGSNAAPCPMYPPLAPALMHCVTHGATPFR
LNLHVRDLGHTFLFGPTGSGKSTHLGILAAQLRRYAGMSIFAFDKGMAMYPLAAAIRAQT
QGRSGRHFTVAADDDQLAFCPLQFLETKGDRAWAMEWIDTLLALNDLHTTPAQRNEIGHA
ILSLHASGGRTLSEFSVTIQDEAIRDAIRQYTVDGAMGHLLDAEEDGLSFSDFTVFEIDE
LMNLGEKYALPVLLYLFRRIERALHGQPAVIMLDEAWLMLGHPAFRAKIREWLKVLRKAN
CLVLMATQSLSDAANSGILDVIVESTATKIFLPNLYARDEDTAALYRRMGLNTRQIEILA
TAIPKRQYYYVSENGRRLYDLALGPLALAFVGASDKESLATIQHLESKLGDGWVHEWLAG
RGLTLDTYGVAA
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgatcgccggaattgccttcgccattgccaccctcggcgccttgctgctgctcgtgctt
tacgcccgcatccgtgcggtcgacgaggaactgaagctcaaaaagcatcgctcgcgggat
gccgggctggccgacctgctcaactacgccgcgatggtcgacgacggcgtgatggtgggc
aaaaacggcgccttcctggctgcctggctgtacaagggcgccgacaacgccagcagcacc
gacgagcaacgcgagatcgtctcgttgcgcatcaaccaggcgctctccggtctcggcaat
ggctggatggtgcacgtggacgcagcgcggctgccagcacccaactatctcgatcgtggc
acctcccactttcccgacggggtgtcggcagcgatcgacgaggagcggcggcaactgttc
gagggtctgggcaccctctacgaaggctactatgtgctgacgctgacctggttcccggcg
ctgctcgcgcagcgcaagttcgtcgagctgatgttcgacgatgacgccaaggcacccgac
cacaaggcgcacacccacggcttgatcgagttcttcaagcgcgagtgcgtcagcatcgag
tcgcggctgtcgtcggcggtggagctgcagcggctacgcggccaccaggtggtcaacgag
gacggttcggcagtcacccacgatgacttcctgcgctggctgcagttctgcgtcaccggc
gtgaatcatccggtgcagttgccgagcaacccgatgtacctggacgcgctcatcggtggg
caggaactgtggaccggcgtcgtgccgaaggtcggccgcaagttcatccaggtcgtcgcc
atcgaaggcttcccgctggaatcgacgccgggcatgttgaccgccctcggtgagctggcc
tgcgaatatcgctggtcgtcgcgtttcatcttcatggatacgcacgaggcggtaagacac
ctcgacaagttccgcaagaaatggcggcagaagattcgcggcttcttcgaccaggtcttc
aacacccacctcgggccgatcgatcaggacgcgctgtcgatggtcgccgatgccgaagcg
gcgattgccgaagtcaatagcggcctagtcgcgcaaggctactacaccagcgttgtcgtg
ctcatggacgaggatcgcagccgcctggaagcgtctgcccgccaggtggaaaaggccgtc
aaccgcctcggcttcgccgcccgcatcgagaccctcaacaccatggacgcctacctcggc
agcctgcccggccacggcgtggaaaacgtccgccggccgctgatcaacaccatgaacctg
gccgatctgctgccgacgagcaccatctggaccggcagcaacgctgccccctgcccgatg
tacccgccactcgcgccggcgctgatgcactgcgtcacccacggcgcgacaccgttccgc
ctgaacctgcacgtgcgcgaccttggccataccttcctgttcggcccgaccggctccggc
aagtcgacccacctcggcatcctcgctgcgcagcttcgccgctacgccggcatgtcgatc
tttgccttcgacaagggcatggcgatgtatccgctcgctgccgccatccgcgcccagacc
cagggtcgcagcggccggcacttcacggtggcggccgacgacgatcagttggccttctgc
ccgctgcagttcctcgaaaccaagggcgaccgcgcctgggcgatggagtggatcgacacc
ctcctcgccttgaacgacctgcacaccacgccggcgcagcgcaacgagatcggccatgcg
atcctcagtctgcacgccagcggcggccgcaccctgtcggaattctcggtcaccatccag
gacgaagcgatccgcgacgcgatccgtcaatacaccgttgatggtgccatggggcacctg
ctggacgccgaagaagacggcttgtcgttctccgatttcaccgtcttcgaaatcgacgaa
ttgatgaacctcggcgagaagtacgcgctgccggtactgctctatctcttccgacgcatc
gagcgcgccctgcacggccagccggccgtgatcatgctcgacgaggcgtggttgatgctc
gggcacccggcctttcgcgccaagatccgcgagtggctcaaggtcttgcgcaaggccaac
tgcctggtgctgatggccacgcaaagtctttccgacgccgccaattcaggcattctggat
gtgatcgtcgaatcgaccgcgaccaagatcttcctgcccaacctctatgcccgcgacgag
gacacggccgccctctaccgccgcatgggcctcaacacccggcagatcgagattctggcg
acagccattcccaagcgccagtactactacgtctcggagaacggccgccgcctgtacgac
ctcgccctcggccccctggcgctcgccttcgtcggcgcctccgacaaggagtcgctggcc
accatccagcacctggagagcaagctgggcgatggctgggtgcacgagtggctggccggg
cggggattgacgctggacacctatggagtcgccgcatga

DBGET integrated database retrieval system