KEGG   Candidatus Accumulibacter regalis: CAP2UW1_4730
Entry
CAP2UW1_4730      CDS       T00966                                 
Name
(GenBank) hypothetical protein
  KO
K20529  type IV secretion system protein TrbD
Organism
app  Candidatus Accumulibacter regalis
Pathway
app02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:app00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CAP2UW1_4730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:app02044]
    CAP2UW1_4730
Secretion system [BR:app02044]
 Type IV secretion system
  Trb secretion system protein
   CAP2UW1_4730
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ACV37852
UniProt: C7RW42
Position
pAph01:complement(162357..162668)
AA seq 103 aa
MALRKIPIRRAGNRDNLFMGGDRELVMFSGLLAFALVFSAQELRATVVGLLLWFGALYAL
RIMAKADPRMRHVYLRHRRYKPYYPARSTPFRDNTTSQGKQYQ
NT seq 312 nt   +upstreamnt  +downstreamnt
atggcgctgcgcaagatccccattcggcgggccggtaatcgggacaacctgttcatgggc
ggcgatcgtgaactggtcatgttctcgggtctgctggctttcgcgctggtcttcagcgca
caggagctgcgggccacggtcgtcgggctgctgctctggttcggcgcgctctacgcgctg
cggatcatggccaaggcagacccccggatgcgccacgtgtacctgcggcaccggcgctac
aagccgtactacccggcgcgcagcacgcccttccgggacaacacgaccagccaggggaag
cagtaccaatga

DBGET integrated database retrieval system