KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_00250Help
Entry
APA22_00250       CDS       T01815                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
apq00010  Glycolysis / Gluconeogenesis
apq00071  Fatty acid degradation
apq00350  Tyrosine metabolism
apq00625  Chloroalkane and chloroalkene degradation
apq00626  Naphthalene degradation
apq01100  Metabolic pathways
apq01110  Biosynthesis of secondary metabolites
apq01120  Microbial metabolism in diverse environments
apq01130  Biosynthesis of antibiotics
apq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA22_00250
  Lipid metabolism
   00071 Fatty acid degradation
    APA22_00250
  Amino acid metabolism
   00350 Tyrosine metabolism
    APA22_00250
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APA22_00250
   00626 Naphthalene degradation
    APA22_00250
Enzymes [BR:apq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APA22_00250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N TrkA_N adh_short AlaDh_PNT_C 2-Hacid_dh_C 3HCDH_N ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: BAI07328
Position
complement(23076..24104)
Genome map
AA seq 342 aa AA seqDB search
MSGKMKAAVVHEFGKPLTIEELDIPPIKPTQILVKMIACGVCHTDLHAASGDWPKKPHLP
FIPGHEGVGTVVQVGSEVDWVKEGDVVGVPWLYSACGHCEHCLAGWETLCAKQEETGYSV
NGCFAEYVVADPNYIAHLPKGVDPVKVAPVLCAGLTVYKGLKMTDTRAGNWVAISGVGGL
GQMAVQYAVAMGLNVVAVDIDDEKLATAKKLGATYTVNARNTDPAAFMQEKVGGVHGGLI
TAVSTKAFSQAMGYVRAGGTLVLNGLPPGDFPISIFDMVMNAITIRGSIVGTRLDMIEAL
SFFAEGKVTSVTTTDRIDNINAIFDALKNGRVEGRVVLDFRN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaaaatgaaagccgctgtggttcatgaatttggcaaaccactgaccattgaa
gaactggacattccccccattaaacctacccagattttggttaaaatgattgcctgcggc
gtgtgccatacagatttgcatgctgccagcggggattggcccaaaaaaccacatctgccg
tttatccccggccacgaaggcgttggcacggttgtgcaggttggcagcgaagtagattgg
gtaaaggaaggcgatgttgttggcgtgccttggctctattctgcctgtggccattgcgag
cattgtctggctgggtgggaaaccctttgcgcgaagcaggaagaaactggctattccgta
aacggctgctttgccgaatacgtggtagcagaccctaactacattgctcatcttcccaaa
ggcgtagaccccgtaaaagttgctcccgtactgtgcgcaggcctgaccgtttataaaggc
ctgaaaatgacagacacgcgggcagggaactgggttgccatttccggcgttggggggtta
ggccagatggctgtgcagtacgccgtagcaatggggctgaatgttgtggcggtagatatt
gatgatgaaaaactggcaaccgccaaaaagcttggtgcaacgtacactgttaacgccaga
aatacagatccggcagcatttatgcaggaaaaagttggtggcgtacacggtggattgatc
accgctgtttccaccaaagcattttctcaggctatgggttatgtgcgggcagggggcact
ttggtgctaaatgggctgccgccgggtgatttcccaatttctatctttgacatggtcatg
aatgccattaccattcgcggctccatagtaggcacacggctggacatgattgaagctctt
tccttctttgcggaaggaaaggtaacatctgtcaccacaacggatcggattgataacatc
aacgcaatttttgatgcgctcaagaacggtcgggtggaaggccgcgtggttctggacttc
cgcaactga

DBGET integrated database retrieval system