KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_11550Help
Entry
APA22_11550       CDS       T01815                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
apq00020  Citrate cycle (TCA cycle)
apq00620  Pyruvate metabolism
apq01100  Metabolic pathways
apq01110  Biosynthesis of secondary metabolites
apq01120  Microbial metabolism in diverse environments
apq01130  Biosynthesis of antibiotics
apq01200  Carbon metabolism
Module
apq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA22_11550
   00620 Pyruvate metabolism
    APA22_11550
Enzymes [BR:apq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     APA22_11550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: BAI08450
Position
1213925..1215634
Genome map
AA seq 569 aa AA seqDB search
MVQEKLPCSRRDEQARAQRCAYNAFQLKACRARILLSCMQKKLGACAGMDPALPACKVQK
ADTADNAETTMSSTTTDTASSVDVVLIGGGVMSATLGTLLRQLQPDWSISIFERLDSVAE
ESSNAWNNAGTGHSALCELNYTPQLADGSVDISKAINVNEQFQVSRQFWTYLVEQNILAS
ARDFLTPVPHMSFVWGDKNVSFLQARYKALSEHPLFSGMEFTQDQAQIAQWAPLIMRNRP
AGQNLAVTRSLRGTDVNFGALTRLLFTYLVSTPACTLHTKHEVHDIRRDADGRWVIKVQD
TRLNTEREVKARFVFIGGGGGALPLLQKTGIPESRGVGGFPVSGQFLRCTNPDLIAQHHA
KIYGKASVGAPPMSVPHLDTRMIDGTPALLFGPYAGFSTRFLKNGSLMDLPRSIRASNIS
AMLAVARDNWPLTKYLIEQVMQSHNDRIKALRDFIPDAQAKDWELVVAGQRVQIIKKDAK
KGGVLQFGTEVISSADGSVAALLGASPGASTAAPIMLTVLKKCFASKLPEWEEKLKQIIP
SYGQKLADNPALCAQLFDKTTSVLGLKEA
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggttcaggaaaagctgccatgctctcgcagagatgagcaggcgagagcgcaacgatgt
gcctataatgctttccagttaaaggcctgccgcgcgcgcatacttctttcttgcatgcaa
aagaagttgggggcatgtgcaggtatggatccagccctgccagcatgtaaggtgcaaaag
gcagatacggctgacaatgcggagaccacgatgagttccaccacgaccgataccgcttct
tctgttgatgtcgtcctgatcggtgggggcgtcatgagcgccacgctgggaaccctgctg
cggcagcttcagccggactggagcatcagcatttttgaacgcctggatagcgtggcggaa
gaaagctccaacgcctggaacaatgccggcacaggccattctgctttgtgtgagctaaat
tacacgccccagctggcagatggcagcgttgatatctccaaggctatcaacgtcaacgag
cagtttcaggtttcccgccagttctggacgtatctggttgagcagaacattctggcttct
gcgcgagattttttaacccccgtgccacatatgagctttgtgtggggggataaaaacgtg
tccttcctgcaggcacgttataaggcgctgagcgaacatccgctgttctccggcatggag
tttacgcaggatcaggcgcagattgcgcagtgggcgccgctgatcatgcgtaaccgcccc
gcagggcaaaatctggcagttacccgcagcttgcgcggcacagatgtaaactttggtgca
ctcacgcgcttgctgtttacctatctggtcagcacgccagcctgcacattgcacaccaag
cacgaggtgcatgatatccgccgtgatgcagatggccgctgggttatcaaggtgcaggat
acgcgcctgaatacggagcgtgaggttaaggcgcggtttgtgtttatcggtggtggtggt
ggtgctctgccgctgttgcagaaaacgggtattccggaatctcgcggtgtgggtggtttc
ccggttagcgggcagttcctgcgctgcaccaacccggatctgattgcccagcaccatgcc
aagatttacggcaaggcttctgttggtgcgcctcccatgtctgttccgcatctggataca
cgcatgatagacggcacaccggcactgttgtttggcccatatgctggtttttctacccgg
ttcctgaaaaacggttccttaatggacctgccgcgttctatccgggcaagcaacatcagc
gccatgctggctgtagcgcgtgataactggccgcttaccaagtatctgatcgaacaggtc
atgcagtcccacaatgatcggatcaaggcgctgcgggactttattcccgatgcgcaggcc
aaggattgggaactggttgtggctggccagcgcgtgcagattatcaagaaagacgccaaa
aaaggcggtgttctgcaatttggtacggaagttatttccagcgcggatggatcagtcgct
gcacttctgggggcttctccgggtgcatcaactgcagccccaattatgctgacggttctg
aaaaagtgctttgccagcaagctgcctgaatgggaagaaaagcttaagcagattatccca
tcttacggccagaaactggcagataatccggcactttgtgcgcagctatttgataaaacc
actagtgttctggggctgaaagaagcctga

DBGET integrated database retrieval system