KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_24240Help
Entry
APA22_24240       CDS       T01815                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
apq00260  Glycine, serine and threonine metabolism
apq00630  Glyoxylate and dicarboxylate metabolism
apq00670  One carbon pool by folate
apq01100  Metabolic pathways
apq01110  Biosynthesis of secondary metabolites
apq01130  Biosynthesis of antibiotics
apq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    APA22_24240
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APA22_24240
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APA22_24240
Enzymes [BR:apq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     APA22_24240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: BAI09677
Position
complement(2624157..2625293)
Genome map
AA seq 378 aa AA seqDB search
MGTDTLLHTPLYSLHEESGGKMVPFAGYAMPLQYADGIMAEHRHVREHVGLFDVSHMGQV
LLRPRSGDVDDAALALEKLVPADIAALKHGRQRYTQFTNAKGGILDDLMVARLEDGLLLV
VNAACKEADLELLQSELVAECVVELQEDRALLALQGPEAEQTLAVFADDVRKMVFMDVRT
LDVDGARCVISRSGYTGEDGFEISVSAKDADRVARKLLEQPNVKLIGLGARDSLRLEAGM
CLYGSDIDTTTTPVEAALEWSIQKSRRNGGARAGGFPGADIILGQLENGVSRRRVGLRPE
GRAPVRHDAPLYADAEFATHIGKVTSGAFGPTVGGPVAMGYVATNDSQTGHTVFAELRGR
SVPSVISALPFVPAHFKR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgatactctccttcatactcccctctattcattgcatgaagaatccggcggc
aagatggtgccgtttgcgggttatgccatgcctttgcagtatgcagatggcattatggcc
gagcaccggcatgtgcgtgagcatgttgggctgtttgatgtctcccatatggggcaagtg
ctgctgcgcccgcgttcgggcgatgtagatgatgctgctttggcgctggaaaaactggtg
ccagcagatatcgctgcccttaagcatggtcgccagcgttatacccagttcaccaatgcc
aaaggtggtattctggatgatctgatggtggcgcgtctggaagatggccttctgctggtg
gtgaatgccgcatgtaaggaagcagatctggaacttctgcaatctgaactggtggcagaa
tgtgttgtagaactgcaggaagatcgggcgctgctcgccttgcagggaccagaagccgaa
cagactttggctgtgtttgccgatgatgtgcgcaagatggtgttcatggatgtgcgcact
ctggatgtggatggcgcccgctgtgtgatttcccgttctggctatacgggcgaagatggg
tttgaaatttctgtttccgccaaggatgcagatcgggttgcccgtaaactgctggaacag
cccaacgtaaaactgattggcttgggtgcgcgagacagtctgcggcttgaagccggcatg
tgcctgtatggttccgatattgataccaccaccacgccggttgaagctgcacttgaatgg
tctatccagaaatctcgccgcaacggtggcgcgcgtgctggtggtttccccggtgcggat
atcattcttggccagcttgaaaatggcgtaagccgccgccgcgttggcttgcggccggag
gggcgtgcacctgtgcggcatgatgcgcctttatatgcagatgcagaatttgccacgcat
atcggcaaggttacctctggcgcatttggccccacagtgggtgggccggtagcgatgggc
tacgtggcgaccaatgacagccagacaggacacaccgtttttgcagaattacgtgggcgt
tccgtgccttccgtaataagtgcactgccttttgtgccagcgcatttcaaacgctag

DBGET integrated database retrieval system