KEGG   Anaerococcus prevotii: Apre_0797
Entry
Apre_0797         CDS       T00964                                 
Name
(GenBank) transcriptional regulator, XRE family
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
apr  Anaerococcus prevotii
Brite
KEGG Orthology (KO) [BR:apr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:apr01002]
    Apre_0797
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:apr03400]
    Apre_0797
Enzymes [BR:apr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     Apre_0797
Peptidases and inhibitors [BR:apr01002]
 Serine peptidases
  Family S24: LexA family
   Apre_0797
DNA repair and recombination proteins [BR:apr03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Apre_0797
SSDB
Motif
Pfam: Peptidase_S24 HTH_3 HTH_19 HTH_31 HTH_26 HTH_37 HTH_60 HTH_11 TnsD Xre-like-HTH Sigma70_r4 Phage_CI_repr S1_2 HTH_5
Other DBs
NCBI-ProteinID: ACV28825
UniProt: C7RH64
Position
complement(898431..899051)
AA seq 206 aa
MSLGAKLKQLREEQEMKQETLAQILGINRATISMYERNQRVPSTEILQKYTKTFNVSSDY
LLGNTHYKSNNINNEKYTIPVYASISCGNPFVADENIYDFEDIDIALKSQGEHFGLLCRG
DSMSPEFKDGDVAIIRKQSDIDSGQVAAVRINGDEATLKIVKKSEQGITLVAINPDVFLP
QFYSNEEIINLPVEIIGRVIENRRKY
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtcattaggtgcaaaattaaaacaattaagagaagaacaggaaatgaaacaagaaacc
ttggcacaaatattaggtataaatagagcgactataagtatgtatgaaagaaatcaaaga
gtccctagtacagaaattttacaaaaatatacaaaaacatttaatgtatcatccgattat
ttattaggaaatacacactataaaagcaacaacattaataacgaaaaatataccatccct
gtatatgcttctatctcatgcggcaatccttttgtggccgatgaaaatatatatgatttt
gaagatatagatatagccctaaaaagtcaaggcgagcactttggtctcctttgtagaggt
gattcaatgagcccagaatttaaagatggagatgtggctataataagaaaacaatcagat
atagacagcggacaagttgcagcagtaagaatcaacggagatgaagccacactaaaaata
gtaaaaaaatcagaacaaggcataactctagtagctataaatccagatgttttcctacct
caattttactcaaatgaagaaataattaacctaccagtagaaataataggaagagtaata
gagaacagaagaaaatactga

DBGET integrated database retrieval system