KEGG   Anaerococcus prevotii: Apre_0153Help
Entry
Apre_0153         CDS       T00964                                 

Definition
(GenBank) Beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
apr  Anaerococcus prevotii
Pathway
apr00010  Glycolysis / Gluconeogenesis
apr00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apre_0153
   00500 Starch and sucrose metabolism
    Apre_0153
Enzymes [BR:apr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Apre_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ACV28205
UniProt: C7RFE4
Position
182439..183812
Genome map
AA seq 457 aa AA seqDB search
MIKFPKDFLFGSATSACQSEGGQVDGKSESIWDYWYKKEPYKFHDRIGPENTSNFYFDYK
ENVELLEKIGHNSFRTSISWARLIPKMDGKVNPKAVDFYENYFKEIKAKGIKLFVNLFHF
DMPMYLQEIGGWENKEVVERYVSYAKTCFKLFGKYADCFFTFNEPIVHVECGYLYQYHYP
CEVNPKKAVQVAYNTQLASALAIKALREIDKDKKIGIILNLTPAYPRSQNENDLKAAEIA
DLFAQKSFLDPSVLGVYPKKLVEIIKKEGLIPEYSKKELDIIKENTVDFLGVNYYQPLRV
MENPYTYKESAIFMPSKYYLSYDMPGKRMNPYRGWEIYPKAIYDIAINIKENYNNIDWMI
TENGMGVENEERFRKDGRIEDDYRIDFIKEHLTYLSKAIDEGANCKGYHLWTFIDNWSWL
NAYKNRYGLVEYKLETGQRLIKKSGLWFKKLSEEKGF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatttcctaaggatttcctatttggttctgcaacatccgcctgccaatcagaa
ggcggacaagttgatgggaaaagtgaaagtatttgggactattggtataagaaagaacct
tacaagtttcacgacagaataggaccagaaaatacatcgaatttttactttgattataag
gaaaatgtagaactcttagaaaaaataggccataattccttcaggacttctatttcttgg
gcaagacttatacctaaaatggacggtaaggtaaatcctaaggccgtggacttttacgaa
aattatttcaaggaaatcaaggccaaaggaatcaagcttttcgtaaatctgtttcacttc
gatatgcctatgtatcttcaagaaatagggggatgggaaaataaggaagttgtcgaaaga
tatgtatcctatgcaaagacttgctttaagctttttggtaaatacgccgactgttttttt
accttcaatgagccaatagttcatgtagaatgtggttatctataccaatatcactatcct
tgcgaagtaaatcccaaaaaggctgtccaagttgcttataatacccaacttgcttcagct
ttggctattaaagccctaagggagatagataaggataaaaaaattggcataatcttaaac
ttaaccccagcttatcctagaagccagaacgaaaacgacctaaaggcggctgagattgca
gacttatttgctcagaaatccttcctggacccatcagttctaggagtttatcctaaaaag
cttgtagaaattataaaaaaggaagggttaattccagaatatagcaaaaaagagcttgat
ataataaaagaaaataccgttgactttcttggagtaaattactaccaacccttgagggtt
atggaaaatccttatacatataaggaaagtgcaatctttatgccaagtaaatattatctt
tcctacgatatgccaggcaagaggatgaatccctacaggggctgggagatatatccaaaa
gccatctacgatatagccataaatatcaaggaaaattacaataatatcgactggatgatt
acggaaaatggcatgggggtagaaaacgaggaaagatttaggaaagacggaaggattgag
gacgattacagaattgattttatcaaagaacatctgacatatctaagtaaggctattgat
gagggggccaactgcaagggttaccatttgtggacctttatagacaactggtcttggctt
aatgcttacaaaaataggtatgggcttgtagaatataagctagaaactggacaaagatta
atcaaaaaatcaggtctttggtttaagaagcttagcgaagagaagggattctag

DBGET integrated database retrieval system