KEGG   Anaerococcus prevotii: Apre_0360
Entry
Apre_0360         CDS       T00964                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07141  molybdenum cofactor cytidylyltransferase [EC:2.7.7.76]
Organism
apr  Anaerococcus prevotii
Pathway
apr00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Apre_0360
Enzymes [BR:apr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.76  molybdenum cofactor cytidylyltransferase
     Apre_0360
SSDB
Motif
Pfam: NTP_transf_3 CTP_transf_3 IspD CofC GP70
Other DBs
NCBI-ProteinID: ACV28409
UniProt: C7RFZ8
Position
412067..412639
AA seq 190 aa
MKINAILMASGLSRRMGENKLMLEFKGKKIYEHTLDLLEEVGFDEVIVATSYDEILEDAR
SRGFVAICNTDNEIGKSSSIKLGVRETDEDANMMFFVADQPLLRKETCDKLIESFKETKL
MTYPVVGMRRGAPVIFPASYRDKLLSLEADQGGMIFAKDGKTNKVPIENEYELLDIDTIE
AYENLRRDHE
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaaaattaatgctatactaatggcctcaggcctatctagaaggatgggagaaaacaaa
ctgatgctagaatttaagggaaagaaaatctacgaacatactctagatctcttggaggaa
gtcggatttgatgaggttatagttgccacttcctacgatgagatcctagaagatgcaagg
tctagaggctttgtggctatttgtaatactgataatgagatcggcaaatcttcatcaata
aaactcggtgtaagggagactgatgaagatgccaacatgatgttttttgtggcagatcag
ccccttcttaggaaagaaacttgcgacaaactaatcgaatcctttaaggaaactaagctt
atgacctatcctgtcgtagggatgagaaggggagcgccagtgatctttcctgctagctac
agggataagcttttaagccttgaagccgaccagggaggcatgatcttcgccaaagacggt
aagactaacaaggtcccaatagaaaacgaatacgaactattggatattgataccatagaa
gcctacgagaatttaaggcgtgatcatgaataa

DBGET integrated database retrieval system