KEGG   Anaerococcus prevotii: Apre_1051
Entry
Apre_1051         CDS       T00964                                 

Definition
(GenBank) FolC bifunctional protein
  KO
K11754  dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
apr  Anaerococcus prevotii
Pathway
apr00790  Folate biosynthesis
apr01100  Metabolic pathways
apr01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Apre_1051
Enzymes [BR:apr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     Apre_1051
    6.3.2.17  tetrahydrofolate synthase
     Apre_1051
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-ProteinID: ACV29079
UniProt: C7RHW8
Position
complement(1125300..1126577)
AA seq 425 aa
MENFNQYYEFILNRGSTSGGHSLEKIKNLLEYFDNPQDKIKVIHIAGTNGKGSTANMIAN
TLSRENRVGLFTSPYMTKINEAISISGVDISDSDFAEIIDRLKKPLEELDKKGLHNSYFE
VLTAIMYIYFYEKKVDVAVVEVGLGGSLDSTNIIKSPLACVITTISKDHIQILGDSLEEI
AQNKAGIIKDKSEVFLYPKEGTVKEVFIKKIENTSSRLHTFDKEEINIIKTGPDYNEFSF
RSYKNIKTRLVGIHQIYNAVTALITLDFLKDEFSICERDIYEGLLTTRNPGRLELINKNP
RVLVDGSHNREAIDALIDSISSYKYRKLIVGFSILKDKDYDYVIDSLAKIADEIIVTKIK
DNPRAFDTDELYSLVKDKAKKAIEIVDLVKAYEYSKELAHEDDLVLWCGSLYLVGDILKN
EKAPR
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggaaaattttaatcaatactacgaatttatattaaataggggaagtacaagtgggggt
catagtctagagaagataaaaaatctcttagaatattttgataatccccaggataaaata
aaggtgattcatattgcaggaactaatggcaagggatctactgccaatatgatcgccaat
acactttcaagggaaaatagggtcggcctatttacttcgccatatatgaccaagataaat
gaagctatatcaatttctggagttgatataagcgatagtgattttgcagaaattattgat
aggttgaagaagcctttggaagaacttgataaaaaaggactccacaattcttattttgaa
gtcttgacagctataatgtatatttatttttatgaaaaaaaggtagatgtcgccgttgta
gaagtaggactaggaggaagtcttgattcaactaatattattaaaagtcctctagcctgt
gtaataactactatttcaaaagaccacatccaaatcctaggtgatagcctagaagaaata
gcccaaaacaaggcgggaattataaaagataagtcagaagtttttctgtatccaaaggaa
ggtacagtgaaggaagttttcataaaaaaaatagaaaatacttctagcagactccatact
tttgataaggaagagattaatataataaaaacaggacctgattataatgagttttcattt
aggtcttataagaatattaagacaaggcttgttggaatccatcagatatataatgcagtg
acagctcttataactttggatttcctaaaagatgagttttctatctgtgaaagagatatt
tatgaaggcttattaactactagaaatcctggtcgacttgaacttataaataagaatcca
agagttttagtcgatggatctcataatagagaagccatagatgccttgattgactctata
tcttcttacaaatatagaaaacttatcgttggattttctattttaaaggataaagattat
gattatgtaattgatagtctggctaagattgccgatgaaatcatagttacaaaaataaaa
gacaacccaagggcctttgatacagatgagctttatagcctagtgaaagataaagctaaa
aaggctatagagattgtagacttagtaaaagcttatgagtattctaaagagcttgcacat
gaagatgacctagttctttggtgtggatccttgtatcttgtgggagatatattaaaaaac
gaaaaagctcctcgataa

DBGET integrated database retrieval system