KEGG   Anaerococcus prevotii: Apre_1159
Entry
Apre_1159         CDS       T00964                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
apr  Anaerococcus prevotii
Pathway
apr00740  Riboflavin metabolism
apr00790  Folate biosynthesis
apr01100  Metabolic pathways
apr01110  Biosynthesis of secondary metabolites
apr01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Apre_1159
   00790 Folate biosynthesis
    Apre_1159
Enzymes [BR:apr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Apre_1159
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Apre_1159
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-ProteinID: ACV29185
UniProt: C7RDC2
Position
complement(1240540..1241739)
AA seq 399 aa
MNRVKEALEALKRNEIILVTDDEDRENEGDMICAGENVTGEMINIMATYAKGLICTPIGK
EVASRLSLNPMVVQNTDNHETAFTVSVDHVNTTTGISAFERAETIRALAAEDSKASDFRR
PGHVFPLVAKDGGVLERDGHTEATVDLLRLAGLKEVGLCCEIMADDGHMMRGDDLLKLAE
KLNLKVTTVSEIKEYRKSLEVDVISTNPVNLPSEYGSFKAYGFLDRKTGKEHIAITKGDI
KKSGVLTRIHSECLTGDVLGSRRCDCGSQLHKALRNIEENGEGVILYLRQEGRGIGLFNK
LKAYELQEHGYDTVDANLKLGFPEDMRDYKIASEMLDRLGVKSVKLMTNNPDKINQLEDY
GIKVESRCPIEIKSNETDRKYLEIKALRMGHELEEFKEI
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaatagagttaaagaagccttagaagcacttaaaagaaatgaaataatcttagtcaca
gatgatgaagatagggaaaatgaaggtgatatgatttgcgccggagaaaatgtcacagga
gagatgataaacatcatggcaacctatgccaagggccttatatgtactcctattggtaag
gaagtagccagtagactttctctaaaccctatggttgtccaaaacactgacaatcacgaa
acagcctttactgtttcagtagatcacgtaaatacaactacaggcatatccgcctttgag
agagcggaaactattagagctcttgcagcagaagattctaaagcgagtgattttagaaga
ccaggccatgtatttcccctagttgccaaggacggaggagttcttgaaagggacggtcat
acagaagcaacagttgatctattaagactagcaggtcttaaggaagtaggactttgctgt
gaaattatggcagacgatggtcatatgatgagaggagatgacctcctaaaacttgctgag
aaactaaatcttaaggtgacaacagttagtgagattaaggagtataggaagagtctagaa
gtagatgtaatatcaaccaatcctgttaatcttcctagtgaatacggtagcttcaaggct
tatggattccttgataggaaaactggtaaagagcatatagcaattaccaagggagatatc
aaaaaaagcggagtcctaacaagaatccattcagaatgcctaacaggagacgtcttaggt
tcaagaagatgcgattgtggtagccagcttcacaaggccctaagaaatatagaagaaaat
ggcgaaggtgttatcctttacctaagacaagagggaagaggcataggactctttaacaag
cttaaggcctacgagctccaagaacacggctacgatacagtagatgccaatcttaaacta
ggatttcctgaagatatgagagactataagatcgcttcagaaatgctagatagacttggg
gtaaaatcagttaagcttatgacaaataaccctgataagataaatcaattagaagattat
ggaataaaagtagagtctagatgtcctatagagataaaatcaaacgaaacagataggaaa
tatctagaaataaaagctttgagaatgggtcacgaactagaagaatttaaggagatataa

DBGET integrated database retrieval system