KEGG   Anaerococcus prevotii: Apre_1351Help
Entry
Apre_1351         CDS       T00964                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
apr  Anaerococcus prevotii
Pathway
apr00071  Fatty acid degradation
apr00280  Valine, leucine and isoleucine degradation
apr00310  Lysine degradation
apr00362  Benzoate degradation
apr00380  Tryptophan metabolism
apr00620  Pyruvate metabolism
apr00630  Glyoxylate and dicarboxylate metabolism
apr00640  Propanoate metabolism
apr00650  Butanoate metabolism
apr00900  Terpenoid backbone biosynthesis
apr01100  Metabolic pathways
apr01110  Biosynthesis of secondary metabolites
apr01120  Microbial metabolism in diverse environments
apr01130  Biosynthesis of antibiotics
apr01200  Carbon metabolism
apr01212  Fatty acid metabolism
apr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Apre_1351
   00630 Glyoxylate and dicarboxylate metabolism
    Apre_1351
   00640 Propanoate metabolism
    Apre_1351
   00650 Butanoate metabolism
    Apre_1351
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Apre_1351
   00072 Synthesis and degradation of ketone bodies
    Apre_1351
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Apre_1351
   00310 Lysine degradation
    Apre_1351
   00380 Tryptophan metabolism
    Apre_1351
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Apre_1351
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Apre_1351
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Apre_1351
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apr04147]
    Apre_1351
Enzymes [BR:apr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Apre_1351
Exosome [BR:apr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Apre_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF2802 FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ACV29374
UniProt: C7RDW1
Position
complement(1452355..1453536)
Genome map
AA seq 393 aa AA seqDB search
MTKKVVIASAARTPVGAYGGAFKTVSARELGAVAAKEAIKRAGIKPEDVDESILGCVLQA
GNGQNIARQIALDAGIPKEKPAMTLNIVCGSGLRSVSLAAQMIMAGDDDIVLAGGTESMS
QAPYLLTDERWGARMGDKKVVDEMIKDGLWDAFNDYHMGVTAENIAEKFGLTREEQDALA
ADSQQKAAKARAEGRFKDEIVPVEVKGRKGKVTVVDEDEYIKEGVTTESISKLRPAFIKD
GTVTAANASGINDGAACLVVMSEEKAKELGVKPLATIVSYATEGVDPKIMGTGPIPTVRK
ALEKADLKLEDIDLIEANEAFAAQALSVIKELGLNTDIVNVNGGAIAIGHPVGASGARIL
TTLLYEMQKRDSKKGIATLCIGGGMGTAVVVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaagtagtaatagcaagtgcagcaagaacacccgtaggagcttacggcgga
gcattcaaaacagtttcagcaagagaattaggtgctgtagcagctaaagaagcaatcaaa
agagcaggtatcaaaccagaagatgttgatgaatcaatcctaggttgtgtacttcaagca
ggtaacggtcaaaacatcgctcgtcaaatcgcccttgatgcaggtattcctaaagaaaaa
ccagctatgacattaaatatagtttgtggatcaggacttagaagtgtatctcttgcagca
caaatgattatggcaggagatgacgatatagttcttgcaggtggtacagaatcaatgtct
caagctccatacctcctaactgatgaaagatggggagcaagaatgggagataagaaagtt
gtcgatgaaatgatcaaagacggactttgggatgcattcaatgactaccacatgggagtt
actgcagaaaatatagctgaaaaattcggcctaacaagagaagaacaagacgcacttgct
gcagacagccaacaaaaagctgctaaagctagagctgaaggaagattcaaagacgaaata
gttccagtagaagttaaaggaagaaaaggaaaagtaactgtagttgatgaagatgaatac
atcaaagaaggcgttacaacagaaagtatctctaaactaagaccagctttcattaaagac
ggtacagttacagcagctaacgcatcaggaatcaacgatggtgcagcatgtcttgtagta
atgagcgaagaaaaagcaaaagagttaggtgttaaaccactagctacaatcgtaagctac
gctacagaaggtgttgatccaaaaatcatgggtactggtccaatcccaacagttagaaaa
gctctagaaaaagctgatcttaaacttgaagatatcgacctaatcgaagctaatgaggct
ttcgctgctcaagctctatcagtaatcaaagaacttggattaaatacagatatagttaac
gttaacggtggtgcaatcgcaattggtcaccctgttggagcaagtggagcaagaatcctt
acaacacttctttacgaaatgcaaaagagagactctaaaaaaggtatcgcaaccctatgt
ataggtggcggtatgggaacagcagtagtagtagaaagataa

DBGET integrated database retrieval system