KEGG   Anaerococcus prevotii: Apre_1422
Entry
Apre_1422         CDS       T00964                                 

Definition
(GenBank) (2Fe-2S)-binding domain protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
apr  Anaerococcus prevotii
Pathway
apr00230  Purine metabolism
apr01100  Metabolic pathways
apr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Apre_1422
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACV29445
UniProt: C7RE32
Position
complement(1537010..1537630)
AA seq 206 aa
MKTKHSREYGPFAPQRVKLSYQKPNYKRVKCTINGIPVEKMVDVRASLTDFLRNDFGLTS
VKKGCEVGECGACSVLIDGESVDSCLYLAIWAEGKDIWTTEGLVADDGSISIIQQAFIDQ
AAVQCGFCTPGFIITATEIVSRGKRYERAELRRLLAGNMCRCTGYENILRAVEEAIEIEI
KGRAEDYETDLAVDPDNTGHDPMIKD
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaagactaaacactctagagaatacggtccatttgctccacaaagagtcaaactaagc
tatcaaaagcctaactacaagagggtaaaatgcactattaatggcatccctgtagaaaaa
atggtagatgtaagggcaagcttaacagactttctaagaaacgacttcggtcttacttct
gtaaaaaagggctgtgaagtaggagaatgtggagcatgttctgtcctaatagacggagaa
agcgtggactcttgtctttatcttgcaatctgggctgaaggaaaagatatctggacaaca
gaaggtctggtagcagatgacggttcgatttcaatcatccaacaagccttcatcgaccaa
gcggcagtccaatgcggtttttgtacaccaggatttataattaccgctacagaaatcgta
tcaaggggaaaaagatacgagagagctgagctaaggagacttcttgcgggaaatatgtgc
aggtgcacaggctacgaaaatatcctaagagctgtggaagaagccatagaaatagaaatt
aagggaagggcagaagactacgagacagaccttgcagtagatccagacaacacaggccac
gacccaatgatcaaggactaa

DBGET integrated database retrieval system