KEGG   Anaerococcus prevotii: Apre_1424
Entry
Apre_1424         CDS       T00964                                 

Definition
(GenBank) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
apr  Anaerococcus prevotii
Pathway
apr00230  Purine metabolism
apr01100  Metabolic pathways
apr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Apre_1424
Enzymes [BR:apr01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Apre_1424
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ACV29447
UniProt: C7RE34
Position
complement(1538518..1540812)
AA seq 764 aa
MYVGKKIKRVDAFDKVTGRAKFTEDLVPKDAYTAKIYHSTIAHGKVLSIDTKEAMKVPGV
VKIVTCFDVPKIQFPTAGHPWSTEKDHQDVADRLLLNEHVRYYGDDVAVVIARDEVACKQ
ALKKIVVEYEEYPANFDALDSIKDVKVPIHEESPDNILKHTTNNRGDFEEAIKEEGLIKV
VGDYETPIISHAHLENPDVYAYEKSGKIVVVASTQIPHIIRRVVGQALGLGWGKIRVIKP
YIGGGFGNKQDALYEPLCAFLTTQVGGHPVKLLPSREETFVSTRTRHAMKIHIESYVRKN
GDYVARRVETYSNGGAYASHGHSIAAKGLNCFHQLYPCENIKGDAYSIYTNLPAGGAMRG
YGIPQAMFAYEAHHDDVAKALGMDPLELKLRNVMPKGYVDPFSHNENYYDSFRDCLEKGA
EAIDYYAKKEKYKNQTGNIRYGIGCAVYWYNTGVFPISLESSSCRMIVNEDGSVQIQLPE
TEIGQGADTAFTQMAADSLGMRIEDIHIISTQDTDVSPFGLGAYASRQTYMASFSITKTA
KELKEKILDQAYLQTRITPNNLDIVDSTIVRKTDGRKLLTMEELATESLYTLKTENQHIT
AETTHTIRTNAFSFGASFAEVKVDIDLAKVEVVKLINVHDAGNIINPQLAEAQAHGGMSM
AVGYALTEEMKYNDKGRILNNNLLDYKLGTIADTPEFEVYFIENPEPTSPYHTKSLGEPP
TCSPAPAIRNAVLNATGISVNKIPMTPHVLFPLFKENGLIDNDL
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgtacgtaggcaaaaaaatcaagagagtagatgcttttgacaaggttacaggtagggca
aagtttaccgaagacctcgttccaaaggacgcatacacagcgaagatctaccattcaact
atagcacacggcaaggttttaagtatagatacaaaagaagccatgaaggttccaggtgtt
gtcaagatagtaacttgttttgacgtgccaaagattcaattcccaacagcaggtcaccct
tggtctaccgaaaaggaccaccaagacgtagctgacaggctcctactcaatgagcatgtt
agatattacggagacgatgtggcggttgtaatcgcccgtgatgaagtagcttgcaaacag
gccctaaagaaaattgtagtcgagtatgaggaatatcctgcaaactttgacgccctcgat
tcaatcaaggatgttaaggttccaatccatgaggaaagccctgacaatatcctaaaacat
actacaaataacaggggagacttcgaagaagctatcaaggaagaaggacttatcaaggta
gttggagattatgaaacacctataatatcccacgcccatttggaaaatccagatgtatat
gcctatgaaaaatcaggcaagattgtagtagttgcctcaacccaaatccctcacattata
agaagagttgtcggccaagccctagggcttggttggggaaagattagagttatcaaacca
tacatagggggaggattcggcaacaagcaagatgccttgtacgagccactttgtgccttc
ctcacaacccaagttggaggtcatcctgttaagcttctcccatcaagagaagagactttc
gtttcaactagaacaagacacgctatgaaaattcacatagaatcttacgtcagaaaaaac
ggtgattatgtagcaagaagagtagaaacttactccaatggaggagcctacgcatcccac
ggtcactctatagccgctaagggattaaactgcttccaccaactctatccttgtgagaat
atcaagggagatgcctactcaatctataccaaccttccagcaggaggggctatgagaggt
tacggtatccctcaagccatgtttgcctacgaagcccaccacgacgatgtggccaaggcc
ctaggcatggatccactagagcttaagcttagaaatgtcatgccaaaaggctacgtagat
cctttctctcacaatgaaaactattacgattccttcagagactgcctagaaaagggagca
gaagccattgactactacgctaagaaggaaaaatacaaaaaccaaacaggaaatatcaga
tacggaataggttgtgctgtctattggtataacactggagtattcccaatttccctagag
tcttcctcttgtaggatgatagttaatgaggatgggtctgttcaaatccaactacctgaa
acagaaattggccagggagctgatactgcctttacccaaatggcagcagattcacttggc
atgaggatagaggatatccatatcatatcaactcaagatacggacgtatctccattcggt
cttggagcttatgcctctcgtcaaacatacatggcaagcttttctattacaaaaactgcc
aaggaattaaaggaaaaaatcctagaccaagcctatctacagacgagaattacaccaaac
aatctcgatatagtagattcaactatagttaggaaaactgacggcaggaagcttcttact
atggaagagctcgctacagagtctctctacaccctaaagactgaaaaccaacacatcaca
gcagagacaacccacacaatcaggaccaatgccttctcctttggggcaagctttgccgaa
gtcaaagtcgacatagatcttgcaaaggttgaagtagttaagcttattaatgtccacgat
gctggaaatataatcaatccacaacttgccgaggcccaggcccacggaggaatgagtatg
gcagtaggctacgccctaacggaggagatgaaatacaatgataagggaagaatcctaaac
aacaacctcctagactacaagctaggtacgattgcggatacgccagagtttgaagtttac
tttatagaaaacccagaaccaacttctccttaccacaccaagtctctgggtgagccacca
acatgctccccagcgccagctataagaaatgcggtcctaaatgcgactggaatttcagta
aacaagattcctatgaccccacacgtactcttcccattatttaaggaaaatggactcata
gacaatgatttataa

DBGET integrated database retrieval system