KEGG   Anaerococcus prevotii: Apre_1436
Entry
Apre_1436         CDS       T00964                                 

Definition
(GenBank) molybdenum cofactor synthesis domain protein
  KO
K03831  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
apr  Anaerococcus prevotii
Pathway
apr00790  Folate biosynthesis
apr01100  Metabolic pathways
apr01240  Biosynthesis of cofactors
apr04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Apre_1436
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Apre_1436
Enzymes [BR:apr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     Apre_1436
SSDB
Motif
Pfam: MoCF_biosynth
Other DBs
NCBI-ProteinID: ACV29459
UniProt: C7RE46
Position
complement(1556911..1557390)
AA seq 159 aa
MRFTAGVLTISDRASSGVYEDKSGKVLVELLEDFGLEVRKYEIVADDFESIKEKLLAYTD
EEISLILTSGGTGFSQRDITPEASLAVIEKRADGIVEAIRNESAKITPMAYLSRAVAGIR
GKSLIINFPGSPKACRENFEIIRPFLFHGLETIAGCDKH
NT seq 480 nt   +upstreamnt  +downstreamnt
atgagatttacggcaggagtgcttacgatttcagacagggcaagctctggagtctatgag
gataagagcgggaaggtcctggtagaattactagaagatttcggtctagaagttagaaaa
tatgagatagtagcagatgatttcgaaagcattaaggagaaattattagcctatactgat
gaagaaatttccctaatacttaccagcggaggcacaggctttagccaaagagacatcaca
cccgaggcaagccttgccgttatagaaaaaagagcggacggcatagttgaagctatcagg
aatgaatccgcaaaaataactcctatggcctatctatcaagagctgtggcaggcattagg
gggaagagcttaatcataaacttcccaggaagccccaaggcttgtagggagaactttgaa
atcataaggccctttctattccacggccttgagacaatcgcaggttgtgacaagcattaa

DBGET integrated database retrieval system