KEGG   Anaerococcus prevotii: Apre_1439
Entry
Apre_1439         CDS       T00964                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein C
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
apr  Anaerococcus prevotii
Pathway
apr00790  Folate biosynthesis
apr01100  Metabolic pathways
apr01240  Biosynthesis of cofactors
apr04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Apre_1439
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Apre_1439
Enzymes [BR:apr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     Apre_1439
SSDB
Motif
Pfam: MoaC Peptidase_M90 NfeD Cu_amine_oxidN1 DUF2258
Other DBs
NCBI-ProteinID: ACV29462
UniProt: C7RE49
Position
complement(1558766..1559254)
AA seq 162 aa
MDKFSHLDENGRARMVDVSKKKETDRLAIATAKVFLNEKTYTMVQNSEIEKGDVLTVAKV
AGIMAAKNTANMIPMCHPINLTSIEIDFVMDDKTHTIEIRTSAKLNAKTGVEMEALTGAS
VAALTIYDMCKAVQKDIEIGEIKLLRKTGGKSGDYKNESYIG
NT seq 489 nt   +upstreamnt  +downstreamnt
atggataagtttagtcatttggatgaaaatggaagagcgaggatggttgacgtatcgaag
aaaaaggagacagataggcttgctatagcgactgccaaggtcttcttaaatgaaaagacc
tacactatggtccaaaactcagaaatcgaaaagggagatgtcttaactgtcgccaaggtc
gcaggaatcatggctgccaaaaacactgccaatatgattcctatgtgccatcccatcaat
ctcacttctatagaaatcgactttgttatggatgataagactcatacaatcgagattagg
acttcagcaaagcttaatgccaagacaggagtcgagatggaggcccttacgggggcgagt
gtggctgcccttacgatttatgatatgtgcaaggcagtccagaaggatatagaaattggc
gagatcaagcttttaagaaagactggcggcaagagtggagattacaagaatgaaagttat
atcggttaa

DBGET integrated database retrieval system