KEGG   Anaerococcus prevotii: Apre_1440
Entry
Apre_1440         CDS       T00964                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein A
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
apr  Anaerococcus prevotii
Pathway
apr00790  Folate biosynthesis
apr01100  Metabolic pathways
apr01240  Biosynthesis of cofactors
apr04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Apre_1440
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Apre_1440
Enzymes [BR:apr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     Apre_1440
SSDB
Motif
Pfam: Radical_SAM Mob_synth_C Fer4_14 Fer4_12 Radical_SAM_2
Other DBs
NCBI-ProteinID: ACV29463
UniProt: C7RE50
Position
complement(1559255..1560193)
AA seq 312 aa
MKDQFGREISYLRISVTDRCNFRCKYCMGEDGIKLLRHEDILTFEEIVETAQIMAGLGIR
KIRLTGGEPFARRGVMDLIKKLSQIPEIEDLAITTNGSMVYDKLESLKEYGISRINFSLD
TLDREKFKLITGADLLEEVKRTIFKAIELDFKVKVNIVLIKGFNDKEIGDFLALTENNDI
EVRFIELMPIGADLDFDRNNYKENLHILDGYRKKDLGFDGVARTFAIEGHKGRVGLISPL
SHKFCKDCNRIRLTADGKLKACLHSREEISIKGLSFEEKKKLIGETIYKKPKSHRLGDFG
SESVRTMSSIGG
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaaagatcaatttggaagagaaatttcatatcttaggatatctgtcaccgacaggtgt
aatttcaggtgcaaatattgcatgggagaagatggaattaagcttcttcgtcacgaggac
atcctaactttcgaggagatagtagaaacagcccagattatggcaggtcttggtattaga
aagattaggttaactggaggcgagcctttcgcaaggcgaggagtgatggatcttataaag
aagctatctcagatacctgagatagaggacttggccataacgacaaacgggtctatggtt
tatgacaagctggagtcccttaaggaatacggtatttctagaattaactttagcctggat
accctggatagggagaaatttaaactaataactggagcagatctcttagaagaagtgaaa
agaactatcttcaaggcaatcgaacttgactttaaggttaaggtcaatattgtcttaatc
aagggctttaatgataaggaaataggagatttcctagcccttactgaaaataacgatatt
gaagtaagatttatcgagcttatgccaatcggagcggaccttgactttgataggaataat
tacaaggaaaatctccatatcctcgatggatataggaaaaaggacctgggctttgacgga
gtggcgaggacttttgccatagaaggtcataagggaagggtcggtctcatatcgccccta
agccacaagttctgcaaggactgcaataggattaggcttactgcagatgggaagcttaag
gcctgcctgcactcgagagaggagatatctatcaagggcctaagctttgaagaaaagaag
aaattaattggagaaactatttacaagaagcccaaaagtcacaggctaggtgattttggc
tcggaaagcgtacgaacaatgagttctatagggggatag

DBGET integrated database retrieval system