KEGG   Anaerococcus prevotii: Apre_1626
Entry
Apre_1626         CDS       T00964                                 

Definition
(GenBank) dihydrofolate reductase region
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
apr  Anaerococcus prevotii
Pathway
apr00670  One carbon pool by folate
apr00790  Folate biosynthesis
apr01100  Metabolic pathways
apr01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:apr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Apre_1626
   00670 One carbon pool by folate
    Apre_1626
Enzymes [BR:apr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Apre_1626
SSDB
Motif
Pfam: DHFR_1
Other DBs
NCBI-ProteinID: ACV29647
UniProt: C7REN4
Position
1772703..1773197
AA seq 164 aa
MKIILAVDKNWGIGKDGQMLFHIRRDLKHFKSYTLGNICIMGRKTYESMGGALTHRENIV
LSRNKDYKAKDAKVFTDYRDVLSYVRERSEEVFVIGGEKIVEIFLEYCDEAIITKIYEKK
DADSFLHNFDQDDDWSLSEESDIMEENGVSFRYVRYRRKNHGKD
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaaaattattttggcagttgataaaaattggggcatcggcaaggatggacagatgctt
tttcatataagaagggaccttaagcattttaagtcctatactttaggaaatatctgtatc
atgggcagaaagacctacgagtccatgggaggcgcccttactcatagggaaaatatagtc
ctttctagaaataaggattataaggcaaaagatgcgaaggtatttaccgactatagggat
gtcctatcctatgtaagggaaaggtctgaggaagtctttgttataggcggggagaagata
gtagaaatcttcctagagtattgcgatgaggccatcattaccaagatttatgagaagaaa
gatgccgatagctttctccacaattttgaccaagatgacgactggtccctaagtgaagaa
tctgatattatggaagaaaatggggtatcttttagatatgtgagatataggaggaaaaat
catgggaaagattga

DBGET integrated database retrieval system