KEGG   Actinosynnema pretiosum: CNX65_00175Help
Entry
CNX65_00175       CDS       T05092                                 

Definition
(GenBank) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00460  Cyanoamino acid metabolism
apre00500  Starch and sucrose metabolism
apre01100  Metabolic pathways
apre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNX65_00175
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    CNX65_00175
Enzymes [BR:apre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     CNX65_00175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Lipase_GDSL_2 PGA_cap baeRF_family2
Motif
Other DBs
NCBI-ProteinID: ATE51895
UniProt: A0A290YYS0
Position
36529..37788
Genome map
AA seq 419 aa AA seqDB search
MTGPDFLWGVSTSAFQIEGGFDEDGRLPSVWDEFPSFEGQTARVACDHRNRHAEDVALLR
ELGVNAYRFSLSWPRVEGGRAARGGSAGGGLDFYDRLVDDLLDAGIAPVATLYHWDTPAH
VEEAGGWLARDTAHRLADYAATAAARLADRVAMWIPVNEPAMVTLLGYATGQHAPGKALL
FDALPTAHHLNLGHGLAVQALRAAGATSVGTANNHTPAWAATGSAEDAAAASAYADLHNW
LYADPVLAGRYPDSLVDLLPVEDGDLATIAQPLDFYGVNYYNPTRLSAPSPGNPLPFDLV
PITEHPVTGFGWPVVPAGLGEMIDALRARHPDLPPVLVTESGCSYPHSLDDTERVDYLAA
HSEAAIAAGAKGYFVWSVLDNFEWDSGYSQRFGLVHVDYATQRRTPRASFRWYRDRIRR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacctgatttcctctggggcgtctcgacttccgccttccagatcgaggggggc
ttcgacgaggacggcaggcttccctcagtgtgggatgaatttccctcgttcgagggacag
accgcgcgggtggcctgcgaccaccgcaaccggcacgccgaggacgtggcgctgctgcgc
gagctgggggtgaacgcgtaccggttctcgctgtcctggccccgcgtcgagggcggccgg
gcggccaggggcgggagcgcgggcggcgggctcgacttctacgaccggctcgtcgacgac
ctgctcgacgcgggcatcgcccccgtcgcgacgctctaccactgggacacgcccgcccac
gtggaggaggcgggcggctggctcgcgcgggacaccgcgcaccggttagccgactacgcc
gccaccgccgccgcccggctggccgaccgggtcgcgatgtggatcccggtcaacgagccc
gccatggtcaccctgctcggctacgccaccgggcagcacgcgccgggcaaggcgctcctg
ttcgacgcgctgcccaccgcccaccacctcaacctcggccacggcctcgccgtccaggcc
ctgcgcgcggcgggcgccacctcggtcggcaccgccaacaaccacaccccggcctgggcg
gccaccggctccgccgaggacgccgccgccgcgagcgcgtacgccgacctgcacaactgg
ctctacgccgacccggtcctcgccgggcgctaccccgactcgctggtcgacctgctgccg
gtcgaggacggcgacctcgccaccatcgcccagccgctcgacttctacggcgtcaactac
tacaacccgacccggctctcggccccgtcaccgggcaacccgctgccgttcgacctggtc
ccgatcaccgagcacccggtcaccggcttcggctggccggtcgtgcccgccgggctcggc
gagatgatcgacgccctgcgcgcccggcacccggacctgccgccggtcctcgtcaccgag
agcgggtgcagctacccgcactcgctcgacgacaccgagcgcgtcgactacctggccgcc
cacagcgaggccgcgatcgccgcgggggcgaagggctacttcgtctggtcggtgctggac
aacttcgagtgggactccgggtactcgcagcgcttcggcctggtccacgtcgactacgcc
acccagcgccgcaccccgcgcgcctccttccgctggtaccgcgaccggatccgccggtga

DBGET integrated database retrieval system