KEGG   Actinosynnema pretiosum: CNX65_03565Help
Entry
CNX65_03565       CDS       T05092                                 

Definition
(GenBank) isoprenyl transferase
  KO
K12503  short-chain Z-isoprenyl diphosphate synthase [EC:2.5.1.68]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00900  Terpenoid backbone biosynthesis
apre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CNX65_03565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:apre01006]
    CNX65_03565
Enzymes [BR:apre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.68  (2Z,6E)-farnesyl diphosphate synthase
     CNX65_03565
Prenyltransferases [BR:apre01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CNX65_03565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: ATE52479
UniProt: A0A290Z0I9
Position
766003..766782
Genome map
AA seq 259 aa AA seqDB search
MGLRERVKNVLLKGYEYRLTRWLDGRQRPRHVGVVLDGNRRWAKEAGFDDVAHGHLAGAR
KILELLNWCRDAEVEVVTLWLLSTDNLTRPTKELEPLLGIIADIVDKLAEPNNPWQVRHV
GALDMLPTETAARLSAASLRTRGRTGLQVNVAVGYGGRQEIADAVRKLLQKHAESGGTIE
ELAEVLDVDHIAEHLYTSGQPDPDLLIRTSGEQRLSGFMLWQSAHSEFWFCEAYWPEFRR
TDFLRALRDYAIRHRRFGS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgggtctccgcgaacgcgtcaagaacgtcctcctcaagggctacgagtaccgcctcacc
cgctggttggacggaagacaacgaccacgccacgtcggcgtggtgctcgacggcaaccgc
aggtgggccaaggaagcgggcttcgacgacgtcgcccacggccacctcgcgggtgcgcgc
aagatcctggagctgctgaactggtgccgggacgccgaggtcgaggtggtcaccctgtgg
ctgctgtccacggacaacctcaccaggcccaccaaggagctcgaaccgctgctcggcatc
atcgccgacatcgtcgacaagctggccgagcccaacaacccctggcaggtgcgccacgtc
ggcgcgctcgacatgctgcccaccgagaccgcggcccgcctgtccgcggcctcgctgcgc
accaggggccgcacggggctccaggtcaacgtggcggtcggctacggcgggcgccaggag
atcgccgacgcggtgcgcaagctgctgcagaagcacgccgagtccggcgggacgatcgag
gagctggccgaggtcctggacgtggaccacatcgccgagcacctctacacctccggccag
cccgacccggacctgctcatccgcacctcgggcgagcagcggctgtccgggttcatgctg
tggcagtcggcgcactccgagttctggttctgcgaggcctactggcccgagttccgcagg
accgacttcctgcgcgccctgcgcgactacgcgatccggcaccgccgcttcggctcctga

DBGET integrated database retrieval system