KEGG   Actinosynnema pretiosum: CNX65_27170Help
Entry
CNX65_27170       CDS       T05092                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00220  Arginine biosynthesis
apre01100  Metabolic pathways
apre01110  Biosynthesis of secondary metabolites
apre01130  Biosynthesis of antibiotics
apre01230  Biosynthesis of amino acids
Module
apre_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CNX65_27170 (argF)
Enzymes [BR:apre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CNX65_27170 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: ATE56501
UniProt: A0A290ZBS8
Position
complement(6395023..6395955)
Genome map
AA seq 310 aa AA seqDB search
MSPRHFLRDDDLTPQEQAEVLDLADELKADPTGPKPLAGPKSVAVIFEKNSTRTRLSFEV
GIAQLGGNPVIVDGRSMQLGREETIEDTSRVLSGYVDAVVWRTFAQKRIEAMASVSRVPV
VNALTDEFHPCQVLADLQTVRRVHGRLAGLTITYLGDGANNMANSTLLGGVTAGMHVRIA
APEAFQTAPWVLEDARKRAAETGGSVEVITDPRAAVDGADVLVTDTWTSMGQENDGRDRT
RPFHPYQVNAALLAATGVEKTTVLHCLPAHRGWEITDEVIDGPASAVWEEAENRLHAQKA
LLVWLLGRTS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtccccccgccacttcctccgcgacgacgacctcacaccgcaggagcaggccgaggtc
ctcgacctggccgacgagctcaaggccgacccgaccggccccaagccgctcgcgggcccc
aagtccgtcgcggtgatcttcgagaagaactccacccgcacccggctctcgttcgaggtg
ggcatcgcccagctcggcggcaacccggtgatcgtggacggccgctccatgcagctcggc
cgcgaggagaccatcgaggacacctcccgcgtcctgtccggctacgtcgacgccgtcgtg
tggcgcaccttcgcgcagaagcgcatcgaggccatggcgtcggtgtcccgcgtgcccgtg
gtcaacgcgctcaccgacgagttccacccctgccaggtgctcgccgacctgcagaccgtg
cggcgcgtccacggccgcctcgccggcctcacgatcacctacctgggcgacggcgcgaac
aacatggcgaactccacgctgctcggcggcgtgaccgccgggatgcacgtgcgcatcgcc
gcccccgaggcgttccagaccgcgccgtgggtgctggaggacgcgcgcaagcgcgccgcc
gagaccggcggttccgtcgaggtcatcaccgacccgcgcgcggccgtcgacggcgcggac
gtgctggtcaccgacacctggacgtccatgggccaggagaacgacggccgcgaccgcacc
cgcccgttccacccctaccaggtgaacgcggccctgctcgccgccaccggcgtcgagaag
accaccgtgctgcactgcctgcccgcgcaccggggctgggagatcaccgacgaggtcatc
gacggcccggccagcgcggtgtgggaggaggccgagaaccggctgcacgcccagaaggcg
ctcctggtctggttgctcgggcgcacgtcgtga

DBGET integrated database retrieval system