KEGG   Actinosynnema pretiosum: CNX65_30715Help
Entry
CNX65_30715       CDS       T05092                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00270  Cysteine and methionine metabolism
apre00920  Sulfur metabolism
apre01100  Metabolic pathways
apre01110  Biosynthesis of secondary metabolites
apre01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CNX65_30715
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CNX65_30715
Enzymes [BR:apre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     CNX65_30715
    2.3.1.46  homoserine O-succinyltransferase
     CNX65_30715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: ATE57125
UniProt: A0A290ZDQ8
Position
complement(7184548..7185579)
Genome map
AA seq 343 aa AA seqDB search
MTGWRDGDPAGGRRWHRGALPGLPFRLAYETWGALDEDRSNAVLVLHALTGDSHVAGPAG
PGHPTAGWWDGLVGPGLALDTDRWFVVAPNALGGCQGSTGPWDAAPDGRPWGERFPAIGI
RDQVAAELGLADALGVRSWAAVVGGSMGGMRALEWAVTAPERVRSLLVLAAPAASSADQI
ALASAQLHALRLHPEQGMAVARRIAHHGYRTAAELNTRFGRSVQGDGRFAVESYLDHQAD
KLAKRFDPGSYRVLTEAMNGHDVGRGRGGVRAALGSVTARTLVAGIDSDRLYPLEQQREL
AEAIPAAGDLRVVASPYGHDGFLVEEEQVAALLGELLEVRSPR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgacggggtggcgcgacggcgatcccgcaggcgggaggcggtggcaccggggcgcgctg
cccggtcttccgttccggctcgcctacgagacctggggcgcgctggacgaggaccggtcc
aacgcggtgctcgtgctgcacgccctcaccggtgacagccacgtcgccggacccgccggt
cccggccacccgaccgccgggtggtgggacgggctggtggggcccggcctcgcgctggac
accgaccggtggttcgtcgtcgcgcccaacgcgctgggcggctgccagggcagcaccggc
ccgtgggacgccgcgcccgacgggaggccctggggcgagcggttccccgccatcggcatc
cgcgaccaggtggccgccgagctggggctggccgacgcgctcggcgtgcgctcgtgggcg
gccgtcgtcggcgggtccatgggcgggatgcgggcgctggagtgggcggtgaccgcgccg
gagcgggtgcggtcgctgctggtgctcgccgcgcccgccgcgtccagcgccgaccagatc
gcgctcgcctcggcccagctgcacgccctgcggctgcacccggagcaggggatggcggtg
gccaggcggatcgcccaccacgggtaccgcaccgccgccgagctcaacacccggttcggg
cggagcgtccagggggacgggcggttcgccgtcgagtcctacctggaccaccaggcggac
aagctggcgaagaggttcgaccccggcagctaccgggtgctcaccgaggccatgaacggc
cacgacgtgggccggggccggggaggggtgcgcgcggcgctgggctcggtgaccgcgcgc
accctcgtcgccgggatcgacagcgaccggctctacccgctggagcagcagcgggagctg
gccgaggcgatccccgcagcgggcgacctgcgcgtcgtggcctcgccgtacggccacgac
gggttcctcgtggaggaggagcaggtcgccgcgctgctgggggagctgctggaggtcaga
agcccgcggtga

DBGET integrated database retrieval system