KEGG   Auxenochlorella protothecoides: ChprMp001Help
Entry
ChprMp001         CDS       T04132                                 

Gene name
nad9
Definition
(RefSeq) NADH dehydrogenasesubunit 9
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00190  Oxidative phosphorylation
apro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ChprMp001 (nad9)
Enzymes [BR:apro01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     ChprMp001 (nad9)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     ChprMp001 (nad9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 22656809
NCBI-ProteinID: YP_009112938
UniProt: A0A0A6ZEF1
Position
MT
AA seq 192 aa AA seqDB search
MSNNFEKSILLMVPQWIQYHVSHRNETTFYVYPEYLKPFLYFLRDHMSTQYKVCVDITAA
DYPSRASRFECVYNLLSVEYNSRIRIKTCVDEYTTLESATPVYSSAAWWEREVWDMFGVF
FHNHPDLRRILTDYGFQGHPLRKDFPLSGYVEVRYDDSEKRVCIESIECTQEFRYFDFDS
PWEQVEKTSIMK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataatttcgaaaaatctatactattaatggtacctcagtggattcaatatcat
gtctctcatagaaatgaaacgactttttatgtataccctgaatatttaaaaccatttctt
tattttttacgcgatcatatgtcaactcaatataaagtatgtgtagatatcactgcagct
gactatccttctcgagcatctcgttttgaatgtgtctacaacttgttaagtgtagaatat
aacagtagaatacgcattaaaacttgtgttgatgaatatactactctagagtcagctact
ccagtatattctagcgcagcttggtgggaacgtgaagtttgggatatgtttggtgtattt
tttcacaaccatcctgatttacgacgcatattaactgattatggatttcaaggacaccct
cttcgtaaagattttcctttaagtggttatgttgaagttcgttatgatgattcagaaaaa
cgagtatgtattgaatctatagaatgtactcaagaatttaggtatttcgattttgatagt
ccttgggaacaagtggaaaaaacttctataatgaaataa

DBGET integrated database retrieval system