KEGG   Auxenochlorella protothecoides: F751_0046Help
Entry
F751_0046         CDS       T04132                                 

Definition
(RefSeq) Aspartate-tRNA ligase, cytoplasmic
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:apro00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    F751_0046
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:apro01007]
    F751_0046
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:apro03016]
    F751_0046
Enzymes [BR:apro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     F751_0046
Amino acid related enzymes [BR:apro01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   F751_0046
Transfer RNA biogenesis [BR:apro03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    F751_0046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA-synt_2d tRNA_anti-codon SIMPL
Motif
Other DBs
NCBI-GeneID: 23611437
NCBI-ProteinID: XP_011401383
UniProt: A0A087S9W2
AA seq 465 aa AA seqDB search
MRSRGFWSVQVPSEGRSEAEKAAKKAAKAAAKAQKEAEKAAKAASRGQKQASVTEADPND
PLASQYGDVELVQSQTISGNVWTKVEKLDPSIEGTTVLVRARVQTVRGKGKSAFLVLRQE
LATVQAVLFVDDNCQQRHGQVELKVTAIRCVARAGPLPFEIADAARGAEAISKATEAGEQ
VVTVLQDTRLDNRIIDLRTPANHSIFRVQSAVTQLFREFLLKEDFVEIHTPKLLGGASEG
GASVFKLDYMGQPACLAQSPQFYKQMAICSDLPRVFEVGPVFRAENSYTHRHLCEFTGLD
MEMTINESYHEVLDVVDRLFHTMFEVDPFGDLNTELERVLGKIVAEKYNTDFYILHRYPS
AIRPFYTMPCKDDERYSCSYDIFIRGEEIISGAQRIHDPSLLERRAKECGIPVETIQAYV
DSFKYGAWPHGGIGVGMERVVMLFCGLDNVRKTSMFPRDPKRLAP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcagaggtttttggtccgtccaggtgccctcggaggggaggtccgaggctgag
aaggctgccaagaaggccgccaaggccgctgccaaagctcagaaggaagccgaaaaagct
gccaaggccgcaagccggggccagaagcaggcatcagtcaccgaggccgacccgaacgat
ccacttgccagccagtacggcgatgtcgagctggttcagagccagacgatctcggggaat
gtatggaccaaggtggagaagttggaccctagcatcgaaggcaccacggtcttggtaaga
gcacgggtgcagaccgttcgtggcaagggcaagtctgcctttttagtgctgcgccaggag
ctggccaccgtgcaggccgtcctctttgtcgatgacaactgtcagcaaaggcatggtcaa
gtcgagctgaaggtcactgccattcgatgtgtggcgcgggcaggtcccctgccctttgag
atcgctgatgctgcacgtggtgcagaggccatatccaaggccacggaagctggcgagcag
gtcgtcaccgtcttgcaggacacgcgtctggacaacaggatcatcgatctccgcaccccc
gccaaccactccatcttcagggttcagtctgcggtcacacagctattccgggagttcttg
ctgaaggaggactttgtggagatccacaccccaaagctcctcggtggtgcctctgagggc
ggcgcatcagtattcaagctggattatatgggacagccagcctgcctcgctcagtcgcca
cagttttacaagcagatggccatctgttcagacctgcctcgtgtgtttgaggtcggcccg
gtcttcagggctgagaattcgtacacgcaccgccacctgtgcgagttcactggtcttgac
atggagatgactatcaacgagtcctaccatgaagttctggatgtagtagacagacttttc
cacacaatgtttgaagttgatccttttggtgatctgaacacggagctggagcgggtcctc
ggcaagattgttgccgagaagtacaacactgacttctacattctgcatcgttacccttct
gctatccgtccattctacacgatgccatgcaaggatgacgagcgatactcctgctcttac
gacatcttcattcgtggcgaggaaatcatctctggcgcccagaggatccacgacccttcc
ctgctggagaggagggccaaggaatgcgggattcctgtggagaccatccaggcatacgtg
gactccttcaagtatggtgcctggcctcatggcggcattggtgtcggcatggaacgagtg
gtcatgctcttctgtggcctggacaatgtgcggaagacgtcgatgttccccagagacccc
aagcgtctggcgccttga

DBGET integrated database retrieval system