KEGG   Auxenochlorella protothecoides: F751_1303Help
Entry
F751_1303         CDS       T04132                                 

Definition
(RefSeq) Protein PHYLLO, chloroplastic
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00130  Ubiquinone and other terpenoid-quinone biosynthesis
apro01100  Metabolic pathways
apro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    F751_1303
Enzymes [BR:apro01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     F751_1303
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     F751_1303
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     F751_1303
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     F751_1303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chorismate_bind TPP_enzyme_N TPP_enzyme_M_2
Motif
Other DBs
NCBI-GeneID: 23612694
NCBI-ProteinID: XP_011400097
UniProt: A0A087SN26
Position
Unknown
AA seq 1048 aa AA seqDB search
MPAPSPPPPPVHVHCQTLPPCKDLAAGKEQVEKALDAAVAARAGLPAALIRCEAQVPRTH
SALAWLQAQRAGTSGAAAPSRPAPTLYFSPRLSPGPDSAGAAAAACEEGAGAVAGVGAAA
LWRGAPGEALDAARLHGMQRFTSAAAPRVRALGGSRFDAQRGLSPEWAAFGTFTFLIPSV
EAAVTLAQELLDEESAEGEAAPCTPSLLDPGTALENYIAGGQQGLDDLLEALEGTPALGA
PATGGDCGTRDPDCGAAALSKVVLARRSELRLSGGADPLALLASLQARNPRAYALFLELE
GGEAFLSCTPERLYSRSGRSVASEAVAGTRARGGGSVENDFWLALDLLQSKKEHAEFTIV
RDWVYEALRGICATVRVDVRKTVLKQESLQHLYGQLSGTLLPAATDADLLAALHPTPAVC
GRPREASRDMLSSLEPFDRGFYSGPFGWLGGQGAEFAVAIRSALFVPEVQAPEFPGVQAL
GPTAMRVALYAGVGIVPGSKASLEWAELDLKVAALDRLLTPVPALQQARKRGSQWGAPNL
NAAYARILVEELCRLGCSTFCIAPGSRSSPLTLAAAQHPRVQLVSGMDERSLAFWALGHG
RSGAAPAVILTTSGTAVANLLPAAVEGWQSGTPLIILTADRPAEVRGSGANQTIHQPGIF
SSYVCWQADLAPPSSAMPPQHLLGSLDRAVAAAGAGPVHLNVQLREPLGPVPEPWESTAW
LEGLGDWATSSRPWSVQLEAAACASRLPHSLLAALSTATRGLLVAGELRAPEDRAAALAV
SRALRWPLLADVLSGLRVGATGVPEGLIACGDNILAAQDPGMCTALRPDVVLQLGGRLTS
KRISAFLAASSARGSSAGNDSAAWWVVDASPHSFDEHGCLAGRVRLPLGALERLLREAGV
LVEGAAAAPFTSPYLELWRTMDREVGFLVRQRLNSAPYGEAHIAACLASSLPRGHALYIG
NSMPIRDMDMFADGLALSGCTQGQVPSLGCPVGANRGASGIDGVLSSAAGFASGLGMPTT
LVVGDLSFLHDTNGLMLLRSGKETWDRA
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgccagcacccagccccccgcccccgcctgtgcacgtccactgccagacgctgcccccc
tgcaaggaccttgccgcaggcaaggagcaggtggagaaggcgctcgacgcggcggtggcg
gccagggccgggctccccgccgccctcatacgctgtgaggcccaggtccctcgaacccat
tcggcgctggcctggctgcaggcgcagcgcgccgggacttcgggggccgctgcaccgagc
cggccggcccccacgctctacttctcgccgcgcctgtcccccggccccgattccgcgggc
gcggcggccgccgcctgcgaggagggcgcgggcgcggtggctggggtgggggcggcggcc
ctctggcgcggggcgccgggggaggccctggacgccgccaggctgcacggcatgcagcgc
ttcacctccgccgccgcgccccgggtcagggccctgggcggctcgcgctttgacgcccag
cgtggcctcagcccggagtgggcagccttcgggaccttcaccttcctcatccccagcgtg
gaggcggcggtcaccctggcccaggagctactggacgaggaaagcgcagagggggaggcg
gcgccctgcacgccctccctgctcgaccccggcacggccctggagaactacatcgcgggg
gggcagcaggggctggacgatcttctagaggcgctggagggtactcctgcactcggcgct
cccgcgacgggaggggactgcggcacccgagaccccgactgcggcgccgccgcactttcc
aaggtcgtgctggcgcggcgctccgagctgcgcctgtccggcggcgccgacccgctggcc
ctgctagcctccctgcaggcccgcaacccacgggcctacgccctgttcctagaactggaa
ggcggggaggccttcctgtcttgcacgcctgagcggctgtacagccgcagcggccgcagc
gtggcctcggaggccgtggccggcacgagggcccgtggcggggggagtgtggagaacgat
ttctggctggccctggacctcctgcagtccaagaaggagcacgccgagttcaccatcgtc
cgggattgggtgtacgaagccttgcgcggcatctgcgccaccgtgcgtgtggacgtgagg
aagacggtgctgaagcaggagtcgctgcagcacctgtacggccagctgtcgggcaccctg
ctgccggctgccacggatgcagacttgctcgccgccctccaccccaccccagccgtgtgt
ggaagacccagggaggcgtccagggacatgctctcctcgctggagccctttgatcgagga
ttctactctggcccgtttggctggctggggggacagggcgccgagtttgcggtggccatc
cgctccgccctctttgtccccgaggttcaagcgccagaatttcctggcgtgcaggccctg
ggcccgacagcgatgcgggtggcgctgtatgccggcgtgggcatcgtccctggctccaag
gcgtccctggagtgggccgaacttgatctcaaagtggcggccctggaccggctgctgacc
cccgttccggcacttcagcaggcaaggaaacgggggagccaatggggggcgcccaacctg
aatgcggcctacgccaggatcttggtggaggagctctgcaggctgggatgctccacattc
tgtatcgctccggggtctcggagctccccactcacactggctgccgcccagcatccccgg
gtccagctggtgtcggggatggatgagcgcagcctggccttctgggcactgggtcacggg
cggtcaggggcagcgccagcagtcatcctgacgacgtctgggacggcggtggcaaacctg
ctcccggccgcggtcgagggctggcagtccggcaccccgctgatcatcctcacggcagac
aggccggcggaggtgcggggctccggggccaaccagaccatccaccagcccggcatcttc
tcctcctacgtctgctggcaggcggacctggcgccccccagctcggccatgccgccgcag
cacctgctggggtcgctggatcgggcggttgctgcggcgggggcgggcccagtgcacctc
aatgtccagttgcgcgagccactgggcccggtgcccgaaccctgggaaagcacggcgtgg
ctggagggcctgggggactgggcgacctcctcccggccgtggagtgtgcagctggaggcc
gccgcctgcgcctcgcgcctcccgcactccctcctcgccgccctgtccaccgcgacccgc
ggcctgctagtagccggggagctgcgcgcgcccgaggaccgcgcggccgccctggccgtc
tcgcgagcgctgcgctggcccctgctggccgacgtgctgtcgggcctgagagtgggggcc
actggagtgccggaagggctgatcgcctgcggcgacaacattctggctgcgcaggatccg
ggcatgtgcaccgctctccgtcccgacgtggtgttgcaactgggtggccggctgacgtcc
aagcggatctcagccttcctggccgccagcagcgcgcgggggagcagcgccggtaatgac
agtgcagcgtggtgggtggtggatgccagcccgcactcctttgatgagcatggctgcctt
gcagggcgggtgcggctgccgctgggcgccctggagcgcctgctgcgtgaagcaggggtg
ctggtcgagggagccgcggcagccccattcaccagtccgtacttggagctctggcggacg
atggaccgcgaggtggggttcctggtgaggcagcgcttgaacagcgcgccgtacggcgag
gcccacatcgccgcgtgcctggcctccagcctgcccagaggccacgcgttatacattggg
aacagcatgcccatccgtgacatggacatgtttgccgacggcctggcattgagcgggtgc
acgcaggggcaagtgcccagcctggggtgcccggtgggcgccaaccgcggcgccagcggc
atcgacggcgtgctgtcctcggcggcggggtttgccagtggactgggcatgcccaccacc
ctggtcgtgggcgacctttcttttctgcacgacaccaacggcctcatgctgctgcgatca
ggcaaggagacctgggacagggcttga

DBGET integrated database retrieval system