KEGG   Auxenochlorella protothecoides: F751_1509Help
Entry
F751_1509         CDS       T04132                                 

Definition
(RefSeq) putative pre-mRNA-splicing factor ATP-dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:apro00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    F751_1509
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:apro03041]
    F751_1509
Enzymes [BR:apro01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     F751_1509
Spliceosome [BR:apro03041]
 Complex C
  Other components
   Step II factors
    F751_1509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind DEAD AAA_22 T2SSE AAA_16 AAA_19 AAA_30 AAA_33
Motif
Other DBs
NCBI-GeneID: 23612900
NCBI-ProteinID: XP_011398791
UniProt: A0A087SJJ1
Position
Unknown
AA seq 896 aa AA seqDB search
MDPLELPIRRFATPIAEAVRDNAVVVVIGETGSGKTTQISQILLDAGLGAGGMVGVTQPR
RVAAVTVARRVAFERKVDVGQEVGYAVRFEECCSRRTSIKYLTDGTLLRELLHDPSLSWY
GVIVLDEAHERSLNTDVLFALLKNLVARRNPPLKLVITSATLDGEKFSAYYGACPVFEVP
GRAFPVEIVHSLDDHSADYLEAAVDTALDIHCNQSEGDILVFLTGQAEIDKAVCQLNAAV
RALPADAAGDLLVLPIYAALPPDMQARARTSVTVEGVVYVIDPGMSKQKDFNPATGLDRL
EVGPISRPRSEPVGRAEPDRASATGCTRKSTTSTRCPTXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXAQDPNRDRFKLVLNCIMILTSVVPPELPMELTIAGGCTAPEIQRTSLAG
VVLYLKSLPLNIDVLGFEYLDPPARPALEAALRSLYVLDAIDGDGVITDIGRRMAALPLT
PHLSRALLAAEDGGCLGNMLSLAGMLSTESSVFLDGVPRPQDAPGSRRGSNQDLEGRDGV
ADGEILDGDEGEHRRLRHALAIGFANQLARRMPLHNGYRTLGERPTLAQVHPSCARLGAD
EDGLLPEWVVYHELIATGHTFLSKVCAVEGAWVAALLPHVSDARARFLARKSQRGG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggacccgctcgagcttcccatacgccgatttgccactccgattgccgaggccgtgagg
gacaatgccgtcgtggtggtcatcggcgaaacagggtctgggaagaccacccagatctcg
cagattctgctggatgccggactgggggcgggcgggatggtgggcgtcacccaaccacgg
agagtggctgccgtcaccgtcgcgcggagggtggcctttgagaggaaggtggatgtgggg
caggaggtgggatatgcggtgcggttcgaggagtgctgctcgcgcaggacctcgatcaag
tacctgacagatggcacgctgctccgcgagctcctgcacgacccttccctctcgtggtac
ggtgtgatcgtgctggatgaagcccacgagcggtcactgaataccgacgtcctcttcgcc
ctactcaagaacctggtggccaggaggaacccccctctcaagctggtcatcacctctgca
accctggacggcgagaagttctcagcctactacggtgcctgccccgtgttcgaggtccct
ggccgcgctttcccggtggagattgtgcattcgctggacgatcacagcgcagattacctg
gaggccgcggtggacacggccctggacatccactgcaaccagtcggagggtgacatcctg
gtcttcctgaccgggcaggccgagatcgacaaggcggtgtgccagctgaatgcggcagtg
cgcgcgctgccggccgatgcggcgggggacctgctggtgctccccatctacgctgcgctg
cctccagacatgcaggcaagggccaggacctccgtcaccgtggagggggtggtgtacgtg
attgaccccggcatgtccaagcagaaggacttcaatcccgccacggggttggaccgcctg
gaggttggacccatctccaggccacgcagcgagccggtcgggcgggccgaacccgaccgg
gcaagtgctaccggctgtacacgcaaaagtactacgagcaccagatgcccaacacnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnggcacaggaccccaaccgggatcggttc
aagctggtcctgaactgcatcatgatcctgacctcggtggtgccccccgagttgcccatg
gagcttaccatcgccggtgggtgtaccgccccggagatccagaggaccagcctggcaggg
gtggtgctctacctgaaatccctccccctcaacatcgatgtgctggggtttgagtacctg
gacccgccagcgaggcccgccctggaagcagcgctgcgcagcctgtacgtgctggacgcc
atcgacggcgacggcgtcatcacagacatcgggcgccggatggcggccctgcccctcaca
ccgcacctctcccgcgcgctactggcggcggaggacggcgggtgcctcggcaacatgctg
agcctggcaggcatgctgagcaccgagtccagcgtattcctggacggggttccccgcccg
caggacgcgccggggtcgcggaggggcagcaaccaggacctggaaggcagggatggcgtg
gccgatggggaaattctggacggggacgagggagaacaccgccgtctgcgccacgccctt
gcgataggtttcgctaaccagctcgcgcgccgcatgcccttgcacaacggctaccgcacc
ctgggcgaacgcccgacgctggcccaggtgcacccgtcctgcgcgcggctgggtgccgac
gaggacggcctgctgccggagtgggtggtgtaccacgagctcatcgccacagggcacacc
ttcctgtccaaggtgtgcgcggtggagggggcctgggtcgcggccctcctcccgcacgtg
agcgacgcgcgcgcgcgcttcctcgcccgcaagtcgcagcgcgggggctga

DBGET integrated database retrieval system