KEGG   Auxenochlorella protothecoides: F751_1708Help
Entry
F751_1708         CDS       T04132                                 

Definition
(RefSeq) Thiamine thiazole synthase, chloroplastic
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00730  Thiamine metabolism
apro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    F751_1708
Enzymes [BR:apro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     F751_1708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 FAD_binding_2 DAO NAD_binding_8 Pyr_redox_2 FAD_binding_3 Lycopene_cycl B12D HI0933_like Pyr_redox_3 GIDA
Motif
Other DBs
NCBI-GeneID: 23613099
NCBI-ProteinID: XP_011397717
UniProt: A0A087SGH5
Position
Unknown
AA seq 419 aa AA seqDB search
MDAQRYATPFDGFKFKGIKESEISRAMTSRYFEDLNVNAEVDVVIVGAGSAGLSCAYELS
KHPDVKIRKPAHKLLDELSIPYDDEGNFVVVKHAALMTSTLLSKVLAAPNIKLFNATAAE
DLIVKDIPAKGGRHVAGAVTNWTLVSLNHDTQMCMDPNTILSKVMVSSTGHDGPMGASGE
VAIIEQGVAPGGGAWLGGQLFSAMCIRKPAHKLLDELSIPYDDEGNFVVVKHAALMTSTL
LSKVLAAPNIKLFNATAAEDLIVKDIPAKGGRHVAGAVTNWTLVSLNHDTQMCMDPNTIL
SKVMVSSTGHDGPMGASGVKRLAKLGMIEKAPGMGALDMNTAEDAVVDRTREIVPGMVIC
GMEVAELDGCPRMGPTFGAMFISGLKAAHCALASLRRQREEAGEVQAETPEQKTLQATH
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggacgcccagcgctacgcaactcccttcgatggcttcaagttcaagggcatcaaggag
tcggagatcagccgcgccatgacctcccgctacttcgaggacctaaacgtcaatgccgag
gtcgatgtcgtcattgttggggctgggtctgcgggcctctcgtgcgcctatgagctgagc
aagcacccggatgtcaagatccgcaagccagcccacaagctgctggatgagctgagcatc
ccctacgatgatgagggcaactttgtggtggtcaagcatgccgccctgatgacctccacc
ctcctgtccaaggtcctcgccgccccaaacatcaagctcttcaacgccactgcggccgag
gacctgattgtcaaggacatccccgcaaagggcggccgccacgtggcgggtgccgtgacc
aactggaccctggtgtcactcaaccatgacacccagatgtgcatggacccaaacaccatc
ctgtccaaggtcatggtgtcttccaccggccacgacggccccatgggcgcctcaggtgaa
gtggccatcatcgagcagggcgtcgcacctgggggtggagcgtggctggggggtcagctc
ttctcggctatgtgtatccgcaagccagcccacaagctgctggatgagctgagcatcccc
tacgatgatgagggcaactttgtggtggtcaagcatgccgccctgatgacctccaccctc
ctgtccaaggtcctcgccgccccaaacatcaagctcttcaacgccactgcggccgaggac
ctgattgtcaaggacatccccgcaaagggcggccgccacgtggcgggtgccgtgaccaac
tggaccctggtgtcactcaaccatgacacccagatgtgcatggacccaaacaccatcctg
tccaaggtcatggtgtcttccaccggccacgacggccccatgggcgcctcaggcgtgaag
cgtctggccaagctgggcatgatcgagaaagcgccggggatgggcgcgctggacatgaat
accgctgaggacgccgtggtggaccgcacgcgcgagatcgtccccggcatggtcatctgc
ggcatggaagtggccgagctggacggctgcccacgcatgggtcccacctttggcgcaatg
ttcatctcggggctcaaggcagcccactgcgcgctggccagcctgaggaggcagcgcgag
gaggctggcgaggtgcaggccgagaccccagagcagaagactctgcaggcgacgcactga

DBGET integrated database retrieval system