KEGG   Auxenochlorella protothecoides: F751_1927Help
Entry
F751_1927         CDS       T04132                                 

Definition
(RefSeq) putative phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00480  Glutathione metabolism
apro00590  Arachidonic acid metabolism
apro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    F751_1927
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    F751_1927
Enzymes [BR:apro01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     F751_1927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 23613318
NCBI-ProteinID: XP_011397936
UniProt: A0A087SH44
Position
Unknown
AA seq 328 aa AA seqDB search
MLRTRSSTLLPVTSRSHLTRERSYNPRRRGNSTVCNPWGIALLLFLLGLAGTGAAWWHFR
DAPAPARAKPVRLASHEAFLSKHSNAHLLEERFEREVQRRRDGGDGALGAQGQADASLGL
GAHHAEAAGAGEGHAAVAAGHDDAAHAAASHLDAVHADAHAAAPPSLYDTSIHVRDASGQ
EVSMAAYRGKVLLVVNVASQCGYTKTNYEALQSLYTRYAGYGLEILAFPCNQFGGQEPGS
LAEIAAWAATTYHVTFPLMDKVDVNGPGETPLFAWLKAHTPGGPPADVDWNFNKFLVDKW
GVPRKRYASAVDYPLLEMDVYSELVRTA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcacccgctcctccaccctcctccccgtgacatctcgctcccatctaacgcgc
gagcgatcttacaacccgcggagaaggggcaactccacagtgtgcaacccctggggcatc
gccctgctcctgttcctgctgggcctggccggcacgggcgcggcatggtggcacttccgg
gatgccccggcccccgctcgggccaagccagtgcggctcgcctcccatgaggccttcctc
agcaagcacagcaacgcccacctgctggaggagcggtttgagcgcgaggtgcagcgtcgg
cgggatggcggcgacggcgccctgggcgcccaggggcaggccgacgccagcctgggcctg
ggcgcgcaccacgccgaggcggcgggcgcaggcgaggggcacgcagccgtggccgcgggg
cacgacgacgccgcacacgccgcagcgtcgcacctggacgcggtccatgccgacgcgcac
gccgccgcgccgccctcgctctatgacacctccatccacgtgcgagacgcgtcgggccag
gaggtgagcatggccgcctaccgcggcaaggtgctgctggtggtgaacgtggcctcgcag
tgcgggtacaccaagaccaactacgaggcgctgcagtcgctgtacacgcggtacgcgggg
tacgggctggagatcctggccttcccctgcaaccagtttggcggccaggagccggggagc
ctggcggagatcgcggcctgggccgcgaccacctaccacgtcaccttcccgctcatggac
aaggtggacgtcaacggacccggcgagacgccgctcttcgcctggctcaaggcgcacacg
cccggaggcccgcccgccgacgtcgactggaacttcaacaagttcctggtggacaagtgg
ggggtgccgcgcaagcgctacgcctccgccgtggactacccgctgctggagatggacgtc
tactcggagctggtgcggacggcctga

DBGET integrated database retrieval system