KEGG   Auxenochlorella protothecoides: F751_2683Help
Entry
F751_2683         CDS       T04132                                 

Definition
(RefSeq) Tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
apro  Auxenochlorella protothecoides
Brite
KEGG Orthology (KO) [BR:apro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:apro01002]
    F751_2683
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:apro03110]
    F751_2683
Enzymes [BR:apro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     F751_2683
Peptidases and inhibitors [BR:apro01002]
 Serine peptidases
  Family S8: subtilisin family
   F751_2683
Chaperones and folding catalysts [BR:apro03110]
 Intramolecular chaperones
  Subtilisin family
   F751_2683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII
Motif
Other DBs
NCBI-GeneID: 23614074
NCBI-ProteinID: XP_011399397
UniProt: A0A087SL61
Position
Unknown
AA seq 1288 aa AA seqDB search
MPKKDIQADAFLKEHPEFDGRGIVVAILDTGIDPGAAALQTTPNGRPKIIDVLDCTGSGD
VDTSTLVTAAADYTIQGVRGSALRLNPAWDNPSGKWHVGSKRLFDLVPKGLADSIRADRR
RVWMQEQRDLLAKATAEVAKLSTQGTPKVTKEEREELEARVALLSEFAEKAEDEGPVLDA
VVWQDASSVWWAALDLTELRGPARGALADFKPMTDFKARRQYTAFSPSDACNFAVNIYDG
GNILSIVVDAGSHGTHVAGITAAYDAAAPHLSGVAPGAQLISCKIGDTRLGSMETAPGLY
RALAAVIQHKADIINMSYGESTATPNSGRFIELAEEVVHEHGVVFVSSAGNSGPALCTVG
APGGTSSAILGVGAWVAPEMAAAGHALREPLRDGQQYNWSSRGPAPDGDVGVALCAPGGA
VAPVPRWTRQRRQLMNGTSMASPCAAGAIALVLSGLKAQGVRPSPARLRRGLEATCLRTS
WDADSVLSQGAGLIQVADAHAFLLAPCSPAASQPWQVTLQRTDAGAAAGGGKRGVFLRTG
QETAVTSTHQVTVKPWFKPEEVAARLDMEVRAELSSERSSFVSHPKHLLLYATGRSFEIQ
VDPRSLEPGLHHTEIRGTDTSDPGAGTLFTIPITVAVPTPVTAGGSQPGADVEIEGEGHA
ELQRPHTFDETLMFAAGIEARRFLDVPEGATWAELRLTASMETPKTLMLRATQLAPHTRF
SDTEWAKSVQLADGGKVEAAFAVSAGTPLELTVAQMWNSLGSCVLRLSLTFHGVTATTPA
KGLLLNGAAGIARLTVRAPLGPERIQPKASLTTLCIPLCPTAAELAPLSAPRDALPRSRL
THQLTLTYSLTLVEGGTVTPRFPRLNRLVYDGILDGQMHVVTDANKKVLGWGDIYPEGIK
LGAGTFAIRVALRHTDADLLQKFKDLPLVAERKLDPSICVPVYTSQAACVTGGAAAKELS
LVHGSSVALFLGNPAEDKLPKDATAGRILSGSVSLGTLASSPGKESPDTLALSFVVPPPK
SDVDKGKGNAPENGNGKKDAADVDADLEKAVLAAQVAFLKACNWLLVLFGKGGWDLKDGS
EEERSTYQRLWDRVFEANKGHLPLLTERLTRLDARSDKDSLVEDRVAAADAVIAAIDTTK
LAVYLAQKSPETGPDKDSRKKDFELQRDAIIQALASKASALLTKYPEVPAETETDEFEAA
FVELQKWVDTSAEGTHANLNAQRLARKGQLALAYRALDKALADDKLASKHKGMLETRVKL
LKQLGWSHWEAAAKARLEISFPATFPLF
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagaaggacatccaagcagatgccttcctcaaggagcaccctgagttcgatggc
cgcggcatcgtcgtcgcgattctggacactgggatcgaccccggcgctgctgcgctgcag
accacgcccaacggcaggcccaagatcatcgacgtcctggactgcactgggagtggggac
gtggacacctccaccctggtcacagcggcagcagactacaccatccagggggtgcgaggc
agcgcgctgcgcctcaaccccgcctgggacaaccccagcgggaagtggcacgtgggcagc
aagcgcctctttgatcttgtccccaagggccttgcagactccatccgggccgacaggcgg
cgggtgtggatgcaggagcagagggatctgctggccaaagccaccgcggaggttgccaag
ctatcgactcaggggactcccaaggtcaccaaagaggaaagggaggagctggaggcacgc
gtggcgctgctctccgagtttgccgagaaggccgaggacgagggcccggtgctggatgcc
gtggtctggcaggatgccagctcggtgtggtgggctgcgctggatctgacggagctgcgt
ggccccgcccgcggcgctctggccgacttcaagcccatgaccgactttaaagccaggcgc
cagtacacggcattctcgccgtccgacgcatgcaactttgccgtcaacatctacgacggc
ggcaacatcctgtccatcgtggtggatgccgggagccacggcacacacgtggccggcatc
accgccgcctacgatgcggcagcgccccacctctccggcgtggcccccggcgcgcagctc
atctcctgcaagatcggcgacacgcggctggggtccatggagacggcgccggggctgtac
agggccctggccgccgtcattcagcacaaggccgacatcatcaacatgagctatggggag
agcacggccacgcccaacagcggccgcttcatcgagctggcggaggaggtggtgcacgaa
cacggcgtggtctttgtctccagcgctggcaacagcggccccgccctgtgcacggtgggc
gccccggggggcacgagctccgcgatcctgggcgtgggcgcctgggtcgcgccagagatg
gccgccgcggggcacgcgctgcgcgagccgctgcgggacggccagcagtacaactggtcc
agccgcggccccgcgcccgacggcgacgtgggcgtcgcgctgtgcgcccccggcggcgcc
gtggcccctgtcccgcgttggacgcgccagcgccgtcagctcatgaacgggaccagcatg
gcctcgccctgcgcggcgggcgccatcgcgctggtcctgtcgggcctcaaggcgcagggc
gtgcggcccagcccagcccgcctgcgccgcgggctggaggccacctgcctgcggacgagc
tgggacgccgacagcgtgctgagccagggcgcgggcctcatccaggtggccgacgcccac
gctttcctcctcgcaccctgcagcccggcggcctcgcagccctggcaggtcacgctgcag
cgcaccgacgcgggcgcggcggcggggggtggaaagcgtggcgtcttcctgcggacgggg
caggagacggcggtgacctccacccaccaggtgacggtcaagccctggttcaagcccgag
gaggtggcagcgaggctggacatggaggtccgcgccgagctttcttcggagcgctcgtcc
ttcgtcagccaccccaagcacctgctcctgtacgccacagggcgcagcttcgagatccag
gtggacccgcggagcctggagccggggctgcaccacaccgagatcagggggaccgacacc
agcgaccccggcgcggggactctgttcaccatccccatcaccgtggcggttcccacgccc
gtgacggccggcggcagccagccgggggcggacgtggagatcgagggcgagggccacgct
gagctgcagcggccccacacctttgacgagacgcttatgtttgccgcggggatcgaggcc
aggcgcttcctggacgtcccagagggggccacctgggcggagctgcgcctcaccgcttcc
atggagacgcccaagacgctgatgctcagggccacccagcttgcccctcacacgcggttc
tcggacactgagtgggccaagtcggtccagctggccgacggcggcaaggtggaggcagcc
tttgccgtcagcgcgggaaccccgctggagctcaccgttgcccaaatgtggaacagtctg
gggagctgtgtgctgcggctgtcattaaccttccacggcgtgacagccaccacaccagcc
aagggcctgctcctgaacggcgcggccggaattgcaaggctgacggtccgtgcacctctg
gggcccgaacgcatccagcccaaggcaagcctgaccacgctgtgcattcccctgtgcccg
acggctgcagagctggcgccgctctccgctcctcgcgacgcgctgcctcgctcccgcctg
acgcaccagctcacgctgacctacagcctgaccctggtcgagggcgggactgtgacgccg
cgctttccacgcctgaacaggctggtgtacgatggcatcctggacgggcagatgcacgtg
gtcaccgacgccaacaagaaggtcctgggctggggtgacatctaccccgagggaatcaag
ctcggggcggggacattcgccattcgcgtggcgctgcggcacactgatgctgacctgctg
cagaaattcaaggacctgcccttggtggctgagaggaagctggatcccagcatctgcgtg
ccggtctacaccagccaggccgcgtgcgtgaccggtggcgcagctgccaaggagctcagc
ctcgtgcatgggtccagcgtggccctcttcctgggcaaccccgccgaggacaagctgccc
aaggatgccacggccgggcgcattctgtcgggctcggtgtccctgggtacactggcttcg
tccccgggcaaggagagcccagacacgctggccctgtcctttgtcgtgccgcccccaaag
agcgacgttgacaagggcaagggcaacgcgccggagaacggcaatgggaaaaaagacgct
gctgatgtggatgccgacctggaaaaggcggtgctggcggcccaggtggccttcctcaag
gcgtgcaactggctgttggtgttgtttggcaaaggaggctgggacctcaaggatgggagc
gaggaggagcgatcaacctaccaacgtctgtgggacagagtctttgaagccaacaaggga
cacctgcccctcctcaccgagcgtctcacgcgattggatgccaggtctgacaaggacagc
ctggtcgaggatcgggttgccgctgctgatgcagtgattgcagcaattgacaccaccaaa
ttggcagtgtatctcgcacagaagtcgcctgagacaggtccagacaaagacagccgcaag
aaagactttgagctgcagagggatgccatcattcaagccttggcatccaaggcatccgct
ctcctcaccaagtatcctgaggtgcccgcggagaccgagaccgatgagtttgaggcggcc
tttgtcgagctccagaagtgggtggacacctccgccgaggggactcacgccaacctgaac
gcccagcgcctcgcccgcaagggacagctagcactggcatacagggcgctagacaaggct
ctggcggacgacaagcttgcatccaagcacaagggcatgctggagacgcgtgtgaagctg
ctgaagcagctgggctggagtcactgggaggctgcagccaaggcccgcctggagatctcc
ttccccgccacattccccctcttttga

DBGET integrated database retrieval system