KEGG   Auxenochlorella protothecoides: F751_2894
Entry
F751_2894         CDS       T04132                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00100  Steroid biosynthesis
apro01100  Metabolic pathways
apro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    F751_2894
Enzymes [BR:apro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     F751_2894
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT Cytochrom_C_asm Steroid_dh ICMT
Other DBs
NCBI-GeneID: 23614285
NCBI-ProteinID: XP_011396509
UniProt: A0A087SD31
Position
Unknown
AA seq 428 aa
MITQQGRHAQEFDFFGPYLGPIGITLGLPVVCYLLYFSCGPEYCFSLKHPALPGLTSSTP
IFSWRALGVYLGWLAFQVLLHLLLPGKHVQGVPLANGERLLYKFTGMQNLVVTLALVFGL
GFATDVLNLGWVYDNYLPLFTASLIVSVLGSVALFAASHSPWRERPPLLAAGGDTGYHIY
DFFIGRELNPRIGSLDLKEFCELIPGLIGWLVIDLACAHKQLQEQGSVSVPMALVCAFQG
LYVWDALYHEPAILTTMDIVSDGFGFMLAFGDTSLVPFTYSLQARLLVSRGPMLGALSIA
GLIALKGLGYATFRGSNSQKDQFRRDPGHASVAHLSSLPTERGTRLLTSGWWGLSRHPNY
LGDWLMAWAWCLPTGSAAGLVPYYYVIYFAALLVHRAMRDDHACRLKYGKDWDKYCKLVR
WRIIPFLY
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgatcactcaacagggccgacacgcccaggagttcgacttctttggtccgtacctgggt
cccataggcatcacccttggacttccagtcgtctgctacctcctgtactttagctgcggg
cctgagtattgcttcagcctcaagcatccggccctccccggcctcacctcctccacacca
attttcagctggcgagccctgggggtgtacctaggctggcttgcgtttcaggtgttactg
cacctcctactgcctggcaagcacgtccaaggagtgcccctggccaatggcgagcgcctc
ctctacaagttcaccggtatgcagaacctggtggtaactctcgccctcgtctttggcctg
ggcttcgccaccgacgtgctgaacctgggctgggtgtacgacaactacctccccctgttc
actgccagcctgatcgtgagcgtgctgggctcggtggccctatttgcggcctcccacagc
ccgtggcgggagcggccgcccctgctggccgcggggggggacactgggtaccacatctat
gacttcttcattggccgcgagctgaacccccggatcgggagcctcgacctcaaggagttc
tgcgagctcatcccggggctgatcgggtggctggtcatcgatctggcctgcgcacacaag
cagctgcaggagcaggggtctgtgtccgtgcccatggccctcgtctgcgcgttccagggc
ctgtatgtctgggacgccctgtaccacgaacccgccatccttaccaccatggacattgtg
tcggacggctttggcttcatgttggcctttggcgacacctcgctggtccccttcacctac
agcctccaggcgcgcctcctggtcagccgcgggcccatgctgggcgcgctgagcatcgca
ggcctgatcgcgctgaaggggctggggtacgccaccttccgcggctccaacagccagaag
gaccagttccggcgcgacccagggcacgccagcgtggcgcacctctccagcctgcccacg
gagcggggcacgcgcctcttgacctcggggtggtggggcctgtcccggcatcccaactac
ctgggggactggctcatggcttgggcctggtgcctgcccactgggagtgcggcagggctg
gtgccctactactacgtaatctactttgcggcgctgctggtgcaccgagcgatgcgggac
gaccacgcatgtaggctcaagtatggcaaggactgggacaagtactgcaagctggtccga
tggcgcatcatccctttcctatactga

DBGET integrated database retrieval system