KEGG   Auxenochlorella protothecoides: F751_3047Help
Entry
F751_3047         CDS       T04132                                 

Definition
(RefSeq) Stromal 70 kDa heat shock-related protein, chloroplastic
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
apro  Auxenochlorella protothecoides
Pathway
apro03040  Spliceosome
apro04141  Protein processing in endoplasmic reticulum
apro04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:apro00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    F751_3047
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    F751_3047
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    F751_3047
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:apro01009]
    F751_3047
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:apro03041]
    F751_3047
   03009 Ribosome biogenesis [BR:apro03009]
    F751_3047
   03110 Chaperones and folding catalysts [BR:apro03110]
    F751_3047
   04131 Membrane trafficking [BR:apro04131]
    F751_3047
   03051 Proteasome [BR:apro03051]
    F751_3047
   03029 Mitochondrial biogenesis [BR:apro03029]
    F751_3047
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apro04147]
    F751_3047
Protein phosphatases and associated proteins [BR:apro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     F751_3047
Spliceosome [BR:apro03041]
 Complex B
  Other components
   Prp19 complex
    F751_3047
 Complex C
   Prp19-CDC5 complex
    F751_3047
Ribosome biogenesis [BR:apro03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    F751_3047
Chaperones and folding catalysts [BR:apro03110]
 Heat shock proteins
  HSP70 / DNAK
   F751_3047
Membrane trafficking [BR:apro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    F751_3047
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    F751_3047
Proteasome [BR:apro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    F751_3047
Mitochondrial biogenesis [BR:apro03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    F751_3047
Exosome [BR:apro04147]
 Exosomal proteins
  Proteins found in most exosomes
   F751_3047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA StbA DP
Motif
Other DBs
NCBI-GeneID: 23614438
NCBI-ProteinID: XP_011397217
UniProt: A0A087SF25
Position
Unknown
AA seq 683 aa AA seqDB search
MQSATMSTAMGTGFLGSKGLRGGRASISGAPLQSRQAFRPAVVGIDLGTTNSAVAAMEGG
KPTIITNAEGGRTTPSVVAFTKAGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMAEVGE
ECKQVPYRVVSDGSSNVKIASPNAKKEFAPEEISAIVLRKLADDASAFLGGAVSQAVITV
PAYFNDSQRQATKDAGRIGGLEVLRIINEPTAASLAYGLDRKSNETILVFDLGGGTFDVS
VLEVGDGVFEVLSTSGDTHLGGDDFDRRIVDWLADDFKAQEGIDLRKDRQALQRLTEAAE
KAKIELSATSTTSVSLPFITATADGPKHIDASLSRSKFEQLASDLLERCRLPLEAALRDA
KLSYSDLDEVILVGGSTRIPAVVGLVERLAQKKPNVTVNPDEVVALGAAVQGGVLAGEVS
DIVLLDVTPLSLGLETLGGVATKVIPRNTTLPTSKTETFSTAADSQSSVEINVLQGEREF
ARDNKSLGNFRLDGIPPAPRGVPQIEVRFDIDANGILSVTASDKGTGKSQDIKITGASTL
PGEEVDRMVKDAEKFAEEDRKRRELVDLKNQADSIVYQTEKQLAEFGDKAPADVKAKLEE
RVEAVKKAAPGEDAAAIKAAIEDLQKEAMALGQAVYGGGAGGAPGAGPEAGAQGGAAPGA
GGAGAGGDDVIDAEFTEGGDNKA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcgcgaccatgagcacggcgatgggcactggcttccttgggagcaagggactg
cgaggcgggcgggcctccatttctggagcacccctgcaatcccgacaagccttccgtccc
gcggtggtgggcatcgatctgggcaccaccaactccgcggtggcagccatggagggaggc
aagcccacgatcatcaccaatgccgagggtggccggaccacgccctccgtggtggccttc
accaaggccggcgaccggctggtcgggcagatcgccaagcgccaggcggtggtgaacccc
gagaacaccttcttctccgtcaagcgcttcatcgggcgcaagatggcagaggttggggag
gagtgcaagcaggtgccataccgtgtggtctccgacggctcctccaacgtgaagatcgca
tcccccaacgcgaagaaagagtttgcgcccgaggagatcagcgccatcgtcctgcgcaag
ctggcggacgacgcgtcggccttcctgggcggcgccgtttcccaggcggtgatcaccgtc
cccgcctacttcaacgactcccagcgccaggcgaccaaggacgcgggccgcatcggcggc
ctggaagtgctgcgcatcatcaacgagcccaccgccgcctccctggcctacggcctggac
cgcaagtccaacgagaccatcctggtgttcgacctgggcggcggcacctttgacgtctcg
gtgctggaggtgggcgacggcgtgttcgaggtgctgagcacctcgggcgacacccacctg
ggcggcgacgacttcgaccgccgcatcgtggactggctggccgacgacttcaaggcgcaa
gagggcatcgacctgcgcaaggaccgccaggcgctgcagcgcctgaccgaggcggcggag
aaggccaagatcgagctgagcgcgacgagcacgaccagcgtgagcctgcccttcatcacc
gccaccgccgatgggcccaagcacatcgacgccagcctgtcgcgctccaagtttgagcag
ctggccagcgacctgctggagcggtgccgcctgccgctggaggccgcgctgcgcgacgcc
aagctgtcctactccgacctggacgaggtgattctggtgggcgggtccacccgcatcccg
gcggtggtgggcctggtggagcggctggcccagaagaagcccaacgtgacggtgaacccc
gacgaggtggtggccctgggcgcggccgtccagggcggcgtgctggcgggggaggtgtcc
gacatcgtgctgctggacgtgaccccgctgtccctgggcctggagacgctgggcggggtg
gccaccaaggtgatcccgcgcaacaccacgctgcccacctccaagacggagaccttctcc
accgccgccgacagccagtccagcgtggagatcaatgtgctgcagggcgagcgcgagttc
gcgcgcgacaacaagtcgctgggcaacttccggctggacggcatcccgcccgcgccgcgc
ggcgtgccccagatcgaggtgcgcttcgacatcgacgccaacggcatcctgtccgtcacc
gcctccgacaagggcacgggcaagagccaggacatcaagatcacgggggccagcacgctg
ccgggggaggaggtggaccgcatggtcaaggacgcggagaagttcgcggaggaggaccgc
aagcgccgcgagctggtggacctgaagaaccaggccgacagcatcgtgtaccagaccgag
aagcagctggctgagttcggggacaaggcgcccgccgacgtcaaggccaagctggaggag
cgggtggaggcggtgaagaaggccgcgccgggagaggacgcggcggccatcaaggctgcc
atcgaggacctgcagaaggaggccatggccctgggccaggccgtgtacggcggcggcgcg
ggcggcgcgcccggggcggggcccgaggcgggcgcgcagggcggcgccgcgcccggcgcg
gggggtgccggagcgggcggcgacgacgtcatcgacgccgagttcaccgaggggggggac
aacaaggcctga

DBGET integrated database retrieval system