KEGG   Auxenochlorella protothecoides: F751_5341Help
Entry
F751_5341         CDS       T04132                                 

Definition
(RefSeq) Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00740  Riboflavin metabolism
apro00790  Folate biosynthesis
apro01100  Metabolic pathways
apro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    F751_5341
   00790 Folate biosynthesis
    F751_5341
Enzymes [BR:apro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     F751_5341
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     F751_5341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHBP_synthase
Motif
Other DBs
NCBI-GeneID: 23616732
NCBI-ProteinID: XP_011401443
UniProt: A0A087SRS4
Position
Unknown
AA seq 321 aa AA seqDB search
MAAVVPCRRPLAVASSSPSTAHGLRGATLPPQRAHPRPRPCSGFRATSSPEAEAAAVTAA
PPEGLASGAVGASLAALPASDLETPTPGFASIAAALAAIAAGELVLVLDSEDRENEGDLI
GAADRITTRATAFLVRHTSGVVCVGMRGADLDRLRLPLMVHSAENEEGLYTAFTVTVDAR
HGITTGISAEERGITLRALGNPATRAQDLRRPGHIFPLRARPGGVLQRPGHTEAGVDLTL
LAGCFPAGALAEVVNDDEDGTMARAPQLAEFAARHGLLRITIADLAALTAHMLRAAGIHS
VRVAEEGLAAMLRAHGLDCRG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtagtgccgtgccggagaccactggcggtggccagctcgtccccctccaca
gcccatggcctgcgcggggcgacactaccaccgcagcgtgcccacccccgcccccgcccc
tgctccgggttccgggccacctccagcccagaagctgaggcagctgctgtgacagcggcg
ccgcccgagggcctggcctccggcgcggtgggcgcgtccctggccgccctccccgcttcc
gacctggagacgcccacccccggcttcgcctccatcgccgccgcgcttgcggccatcgcc
gcgggggagctggtgctggtgctggactcggaggaccgcgagaatgagggcgacctgatc
ggcgccgcggaccgcatcaccacgcgcgccaccgccttcctggtgcgccacaccagcggc
gtggtgtgcgtgggcatgcgcggcgcggacctggaccgcctccgcctgccgctcatggtg
cacagcgcggagaacgaggaggggttgtacaccgccttcacggtgaccgtggacgcgcgg
cacggcatcaccaccggcatctcggccgaggagcgcggcatcacgctgcgcgcgctggga
aaccccgccacccgcgcccaggacctgcggcggcctgggcacatcttccccctccgcgcc
cggccgggtggcgtgctgcagcggcccgggcacaccgaggcgggcgtggacctgaccctc
ctggcgggctgcttccccgccggcgcgctggcggaggtggtgaacgacgacgaggatggg
accatggcccgcgcgccgcagctggcggagtttgccgcacgccacggcctgctgcgcatc
accatcgccgacctggcggcgctgaccgcgcacatgctgcgcgcggcgggcatccacagc
gtgcgcgtcgcggaggagggcctggccgccatgctgcgcgcgcacggcctcgactgccgg
ggctga

DBGET integrated database retrieval system