KEGG   Auxenochlorella protothecoides: F751_5518Help
Entry
F751_5518         CDS       T04132                                 

Definition
(RefSeq) putative fructose-bisphosphate aldolase 3, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00010  Glycolysis / Gluconeogenesis
apro00030  Pentose phosphate pathway
apro00051  Fructose and mannose metabolism
apro00710  Carbon fixation in photosynthetic organisms
apro01100  Metabolic pathways
apro01110  Biosynthesis of secondary metabolites
apro01200  Carbon metabolism
apro01230  Biosynthesis of amino acids
Module
apro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
apro_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
apro_M00165  Reductive pentose phosphate cycle (Calvin cycle)
apro_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
apro_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F751_5518
   00030 Pentose phosphate pathway
    F751_5518
   00051 Fructose and mannose metabolism
    F751_5518
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    F751_5518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:apro04131]
    F751_5518
   03036 Chromosome and associated proteins [BR:apro03036]
    F751_5518
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apro04147]
    F751_5518
Enzymes [BR:apro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     F751_5518
Membrane trafficking [BR:apro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    F751_5518
Chromosome and associated proteins [BR:apro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    F751_5518
Exosome [BR:apro04147]
 Exosomal proteins
  Proteins found in most exosomes
   F751_5518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic SQS_PSY
Motif
Other DBs
NCBI-GeneID: 23616909
NCBI-ProteinID: XP_011395675
UniProt: A0A087SAQ5
Position
Unknown
AA seq 523 aa AA seqDB search
MIGGMRMDLEKSRYETYDELYDYCYRVAGTVGLMSAPVMGIDTQYKGPLDPVYRAALSLG
TANQLTNILRDVGEDAQQRSRVYLPLDELARFGISPGEVLEGTLARAPGQVDPRWAAFMR
FQIERTRAVFSEAEGGIRQLSRDARWPVWSALILYRQILDAIEANGYDNFTRRAYVPKWR
KLATLPSALVLAQAPWKTIASPGKGILAMDESNATCGKRLEGIGLENTVENRQTYRELLV
TTPGLGEYISGAIMFEETLFQDTRKGTKMTEELKKQGIVPGIKVDKGCAGLDGLDVRCGE
YYRAGARFAKWRSVVSIPSGPTPLAVRDCAYGLARYAALAQSAGLVPIVEPEILLDGEHD
IDRTLEVASAVWAETFKYLADNNVLFEGILLKPSMVTPGADSGNPAAPEVVADYTLRLLR
RRVPPAVPGIMFLSGGQSELEATLNLNAMNQSPNPWHVSFSYARALQNSVLRTWKGEEAN
FEAAQKALIKRAAANSTAQRGQYDPANESEEAAKGMYEKGYTY
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcggcatgcgcatggacctggagaagtcgcggtacgagacctacgacgagctg
tacgactactgctaccgtgtggcaggaacggtgggcctcatgtccgcgcccgtcatgggc
atcgacacgcagtacaagggacccctggacccagtgtaccgcgccgcgctgagcctgggc
accgccaaccagctcaccaacatcctcagggacgtgggcgaggacgcacagcagcgcagc
cgggtgtacctgccactggacgagctggcacgcttcggcatcagccccggggaggtgctg
gagggcacgctggcgcgcgcgcccggccaggtggacccgcgctgggcggccttcatgcgc
ttccagatcgagcgcacgcgcgccgtcttctccgaggcggagggcggcatccgccagctg
tcgcgcgacgcgcgctggccggtgtggagcgcgctcatcctgtaccgccagatcctggac
gccatcgaggccaatgggtatgacaacttcacgcgccgcgcctacgtgcccaagtggcgc
aagctggccaccctgccctcggccctggtcctggcccaggcgccctggaaaaccatcgcc
tctcctggcaagggcatcctggccatggacgagtccaacgccacctgcggcaagaggctg
gagggcatcggcctggagaacacggtggagaacaggcagacctaccgcgagctcctggtg
accaccccgggcctgggcgagtacatctcaggcgccatcatgtttgaggagactctgttc
caggacacccgtaagggcaccaagatgaccgaggagttgaagaagcagggcatcgtcccc
ggcatcaaggtcgacaaggggtgcgcaggcctggacggcctggacgtgcggtgcggggag
tactaccgcgcaggcgcgcgcttcgccaagtggcgtagcgtggtgtccatcccctccggg
cccacccccctggcggtgcgcgactgcgcctacggcctggcgcggtacgccgcgctggcg
cagagcgcgggcctggtgcccattgtggagcccgagatcctgctggacggcgagcacgac
atcgaccgcacgctggaggtggccagcgctgtgtgggcggaaaccttcaagtacctggcg
gacaacaacgtgctgttcgagggaatcctgctcaagccctccatggtgaccccgggcgcc
gactccggcaaccccgccgcgcccgaggtggtggccgactacacgctgcgcctgctgcgc
cgcagggtgccgcccgccgtcccgggcatcatgttcctctccggcggccagtccgagctg
gaggccacgctcaacctgaacgccatgaaccagtcgcccaacccctggcacgtcagcttc
tcctacgcgcgcgcgctgcagaactccgtgctgcgcacctggaagggggaggaggccaac
ttcgaggccgcgcagaaggcgctgatcaagcgcgccgccgccaactccaccgcgcagagg
ggtcagtatgaccctgccaacgagtccgaggaggcggccaagggcatgtacgagaagggg
tacacctactga

DBGET integrated database retrieval system