KEGG   Acidihalobacter prosperus: BI364_05150Help
Entry
BI364_05150       CDS       T04495                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00860  Porphyrin and chlorophyll metabolism
aprs01100  Metabolic pathways
aprs01110  Biosynthesis of secondary metabolites
aprs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BI364_05150
Enzymes [BR:aprs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BI364_05150
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BI364_05150
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BI364_05150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: AOU97445
UniProt: A0A1D8ILV6
Position
1092933..1094372
Genome map
AA seq 479 aa AA seqDB search
MDWYPVFWNLRGHPVLVVGGGRVAARKVAALLRAGATVSVAAEGVCGQLRDAYEAGRIAY
LAGAYVAEVLRGQRLVIAATDDPSINHRIAWDARDAGIPVNVVDDPEHCDFILPAVVDRS
PLLIAISSGGRAPMLVRHLKTYLEARLPRALANLTEQMGRLRGCVKARLPTPAARRAFWE
HVLGGSELVQIDAQRMRDVRRNLVRHAEAPDTASGPPLVALVGAGPGDPDLLTLKALQLI
QGCDVVLHDALVSASILALVRPEAERVFVGKRAGGVHTPQAEIERRMIAYARRGLRVVRL
KGGDPMIFGRGGEEMQALEQAGIPFEVVPGISAANGCAAYAGIPLTHRRHAHTLVMTSGC
IHPDGSEHDWSVLARRRQTLVFYMPLRELDLICKQLVAHGLPSDWPAMLIFEGTAPAQRV
LRGTLMSLPRLATADGMVSPAVLVVGEVTALADRLDEDGTPSPITGDARERRDTVYALL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggattggtatcccgtattctggaatctgcgaggacatccggttctcgtcgtgggcggc
ggccgggtggcggcgcgcaaggtggctgcactgttacgtgcgggtgcgacggtcagcgtg
gccgctgagggtgtgtgcggccagttgcgggatgcatacgaggcgggccggatcgcgtat
ctcgccggtgcctacgtggccgaggttctgcgtgggcagcgtctggtaatcgctgccacg
gacgacccgtcgatcaatcatcgcatcgcatgggatgcacgcgatgcgggcatccccgtg
aatgtagtggatgatccagagcactgcgactttattctgccggccgttgtcgaccgttcg
cccctgctgatcgcgatctcgtccggcggccgagcgccgatgctcgtgcgtcatctcaag
acgtacctggaggcccggctgccgcgcgccctggcgaatttgaccgagcagatggggcgc
ctgcgaggatgcgtcaaggcccgtttgccgacgccggctgcgcggcgtgccttctgggaa
cacgtgctgggaggctccgagctggtccagatcgacgcgcaacggatgcgcgatgtccgg
cgaaacctggtacggcatgcggaggcgccagacacggcaagtggtccgccgttggttgcg
ctggtgggggcgggtccaggtgatccggatctgctgacgctcaaggcgctgcaactcatt
cagggttgcgacgtggtgctgcacgatgcattggtgtctgcgtcgatcctggcgctcgtg
cgtcccgaagcggagcgcgtgttcgtcggcaagcgtgccggcggcgtgcacacacctcag
gcggaaatagagcggcggatgattgcctatgcccgccgtggtttgcgtgtggtgcgcctc
aagggcggcgatccgatgattttcggccgtggcggcgaggagatgcaggccctggagcag
gcgggcattccattcgaggtggtgccagggatcagtgccgccaatggctgcgctgcctat
gcgggcattccgctgacccatcgccggcatgcgcatacgctggtgatgacctccggttgc
atccatcccgatggcagcgagcacgattggtccgtactggcgcggcgccgtcaaacgctg
gtgttctatatgccgctgcgtgagctcgacctgatctgcaaacagctagtcgcacacggc
ctgccgtccgattggccggcgatgctgatcttcgaagggaccgctcccgcgcagcgtgtg
ctgcgtgggactctgatgtccttgccaagactcgccacggcagatggcatggtgtcgcct
gccgtcctagtggtcggcgaggtcaccgccttggctgatcgcctggatgaagatggcacg
ccatcgccgattaccggcgatgcacgtgagcggcgcgatacggtgtatgcactgctttga

DBGET integrated database retrieval system