KEGG   Acidihalobacter prosperus: BI364_06195Help
Entry
BI364_06195       CDS       T04495                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00071  Fatty acid degradation
aprs00072  Synthesis and degradation of ketone bodies
aprs00280  Valine, leucine and isoleucine degradation
aprs00310  Lysine degradation
aprs00362  Benzoate degradation
aprs00380  Tryptophan metabolism
aprs00620  Pyruvate metabolism
aprs00630  Glyoxylate and dicarboxylate metabolism
aprs00640  Propanoate metabolism
aprs00650  Butanoate metabolism
aprs00900  Terpenoid backbone biosynthesis
aprs01100  Metabolic pathways
aprs01110  Biosynthesis of secondary metabolites
aprs01120  Microbial metabolism in diverse environments
aprs01130  Biosynthesis of antibiotics
aprs01200  Carbon metabolism
aprs01212  Fatty acid metabolism
aprs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aprs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BI364_06195
   00630 Glyoxylate and dicarboxylate metabolism
    BI364_06195
   00640 Propanoate metabolism
    BI364_06195
   00650 Butanoate metabolism
    BI364_06195
  Lipid metabolism
   00071 Fatty acid degradation
    BI364_06195
   00072 Synthesis and degradation of ketone bodies
    BI364_06195
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BI364_06195
   00310 Lysine degradation
    BI364_06195
   00380 Tryptophan metabolism
    BI364_06195
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BI364_06195
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BI364_06195
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BI364_06195
Enzymes [BR:aprs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BI364_06195
Exosome [BR:aprs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BI364_06195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOU97601
UniProt: A0A1D8IMG2
Position
1310752..1311933
Genome map
AA seq 393 aa AA seqDB search
MSEIVIVSARRTPIGVFRGALADLPAPALGAAAIRAAVADAQLAPDVVSEVIMGCVLSAG
LGQAPARQAALAAGLALSVGCTTVNKVCGSGMKAIMFGHDLIRAGSAEVVVAGGMESMSG
APHLIPGSREGHRYGSFEVLDHMARDGLTDAYDGQPMGLFGEATAERYGFDRARQDAFAV
ASVERARTAQSSGGFEAELVRLSLGNADDAAPPIGQDEGPSRCEPSRIALLRPVFRRDGG
TITAATASSIADGAAAMVLMSAETAAARGLVPLARIVGHAGHSQAPEWFTTAPVGAIERL
LRQVGWDVRAVDLFEVNEAFAVVAMAVMEELGIDHARMNVNGGACALGHPIGASGARIVV
TLLHALRARGLRRGVAALCIGGGEATAIAVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagattgttatcgtcagtgcgcgccgcactcccatcggcgtgtttcgtggcgcg
ttggcggatttgccggcccctgcgctcggtgccgctgccatccgtgccgcggtagcggac
gcacaactcgcgccagacgtggtctcggaggtgatcatgggttgcgtgctgagcgcaggc
ctcggccaggcgcctgctcggcaggcggcattggccgctggattggccctgtcggtcggt
tgtacgaccgtgaacaaggtttgcggatcggggatgaaggcgatcatgttcgggcacgat
ctgatccgtgccggttcggcggaagtggtggtggcaggcggcatggaatcgatgagtggg
gcccctcatttgattcccggctcgcgcgaggggcatcgttacgggagcttcgaggtgctc
gatcacatggctcgcgatggtctgactgatgcctacgatggtcaaccgatgggcctgttc
ggcgaggcaacggcagagcgttacggtttcgatcgggcgcgtcaggatgccttcgcagtt
gcttcggtcgagcgtgcacgtacggcgcaatcgagtggggggtttgaggctgagctggta
cggctgtcgcttggaaatgccgacgatgcggcccctccgatcggtcaggacgaagggcct
tcacgatgcgagccctcgcggatcgctctgctgcggccggtcttccgtcgagacggcggt
acgattacggccgccacggcttcgagtatcgccgacggcgcggccgcgatggtgttgatg
tctgcggaaacggcggcggcacgcgggctcgttccgttggcccggatcgtgggtcatgcc
ggacattcgcaagcgccggagtggtttaccacggcgccggtgggagctatcgagcgtctg
ttgcgtcaggtcggttgggatgtgcgggcggttgacctgttcgaagtcaacgaagccttc
gcggtagtcgccatggcggtgatggaggagttgggtattgaccacgcgcgtatgaacgtc
aacggcggggcctgtgccctgggtcacccgatcggtgcaagtggtgcgcgaatcgtggtc
acgctattgcacgcgctgcgcgcgcgcggccttcggcgcggtgtcgcggctctgtgcatc
gggggtggcgaggcgacggcaatcgccgtggagcggatctga

DBGET integrated database retrieval system