KEGG   Acidihalobacter prosperus: BI364_08725Help
Entry
BI364_08725       CDS       T04495                                 

Definition
(GenBank) 3-phosphoglycerate dehydrogenase
  KO
K16843  (S)-sulfolactate dehydrogenase [EC:1.1.1.310]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00270  Cysteine and methionine metabolism
aprs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BI364_08725
Enzymes [BR:aprs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.310  (S)-sulfolactate dehydrogenase
     BI364_08725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AOU98034
UniProt: A0A1D8INN5
Position
complement(1832636..1833574)
Genome map
AA seq 312 aa AA seqDB search
MSDVVISEFMDGDAVEALRARLKVRYEPDLADHPIRLADYLHAARALIVRNRTRVDAKLL
ATAPRLRVVGRLGVGLDNIDLDYCRHRGIRVLPAIGANNIAVAEYVIATMLILVRGSFGA
TGAMLTGQWPRAALVGGEVQGRELGLVGFGGIARAVACRARGLGLVVRAFDPGLNAADSV
WAQHAVEPVDSLASLLAGCDVLSLHVPLNADSRHLMGTQELALMRPGSILINTARGGVVD
DAALSAALREGRLAGAALDVFETEPLSAHSMFHDLENLILTPHIAGVTRESNARVSRMIG
EAVVQTLEEGPA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtcgtcatcagcgaattcatggatggtgatgcggtcgaagcgttgcgcgcg
cgcctgaaggtgcgttacgaaccggatctggctgaccatcccatccgtttggcggattac
ctgcacgcggctcgggcgttgatcgtgcgcaatcgtacgcgtgtcgatgcaaaactgctg
gcgaccgcgccgcgcttgcgggtagtggggcgcctcggcgttgggctggacaacatcgat
ctagactattgtcgacatcgcggcatacgcgtacttccggccatcggtgccaataatatc
gcggttgcggaatacgtcatcgccacgatgctgattctggtgcgcggcagttttggcgca
accggagcaatgctcactggccaatggccgcgcgccgcactcgttggcggcgaagtccaa
ggtcgcgagttgggtctggtagggtttggcggcatcgcgcgcgcggtggcatgccgtgcg
cgcggactggggcttgtggtacgtgcattcgatcccggcctgaatgccgctgacagtgtc
tgggcacagcatgcggttgagccggtcgattcgcttgcgagtctgcttgctgggtgcgat
gtgttgagtctgcatgttcccctgaatgcagactctcgccatcttatgggtacgcaggaa
ttggcgttaatgcgtcccgggtcaatcctgatcaataccgcccgtggcggtgtcgttgat
gatgctgccctgagtgcagcgctgcgcgaaggtcgcttggctggagccgcgctcgatgtc
ttcgaaacagagcctctgtcggctcactcgatgttccatgatttggaaaatctcatactg
acaccccatattgccggcgtcacgcgcgaatcgaatgctcgcgtcagccgcatgatcggt
gaggcggtggtacaaaccctggaggaaggaccggcatga

DBGET integrated database retrieval system