KEGG   Acidihalobacter prosperus: BI364_08950Help
Entry
BI364_08950       CDS       T04495                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00430  Taurine and hypotaurine metabolism
aprs00620  Pyruvate metabolism
aprs00640  Propanoate metabolism
aprs00680  Methane metabolism
aprs01100  Metabolic pathways
aprs01120  Microbial metabolism in diverse environments
aprs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BI364_08950
   00640 Propanoate metabolism
    BI364_08950
  09102 Energy metabolism
   00680 Methane metabolism
    BI364_08950
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BI364_08950
Enzymes [BR:aprs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BI364_08950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AOU98073
UniProt: A0A1D8INM8
Position
complement(1875929..1877128)
Genome map
AA seq 399 aa AA seqDB search
MKSANSRILTINGGSSSIKFALFEAGDPLELMLEGGIERIGLPEAILRVKGVEPADNFSR
SVMAQDHKAAVEVLMDWIEQRLSRDALIAVGHRVVHGGPKYSEAQRITTEMVEELRELSP
FDPEHLPEEIMLTEAFHHRFPDLPQVACFDTAFHHDLPRVAQLLPLPRRYEAQGVRRYGF
HGLSYAFLMEELARLAGAEAAHGRVILAHLGNGASLAAIGGGKCVDTSMAFTPTAGIPMS
TRSGDLDPGLFGYLARSENMSATQFNEMVNFQSGLLGVSETSSDMRDLLACEGRDVRAAE
AIDLFCYQVKKYIGAYAAVLGGLDTLVFAGGIGENASLVRQRVCDGLGFLGIELNHERNA
ESSALISADNGLVEVRVIHTNEALMIAKSVVHVLSTKET
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgcgaattcacggattctgacgatcaacggtggctcgtcgagtatcaagttc
gcgttgttcgaggcgggtgatccgctggaacttatgctggagggcgggattgagcggatc
ggattgcccgaggctattttgcgagtgaagggcgtggagccggcggataacttttcgcgg
tcggtgatggctcaagatcacaaggcagcagtggaagtgttaatggattggatcgagcaa
cgcctcagtcgtgatgccttgatcgcggtgggacatcgcgtggtgcatggtgggcctaaa
tacagcgaggcgcagcgaatcaccacggaaatggttgaggaactgagagaactcagccct
ttcgatcccgaacatctgccagaagaaattatgttgaccgaggcgtttcatcatcggttt
ccagatttgccccaggtggcgtgtttcgacacagcgtttcatcatgacctgccgcgggtg
gcgcaactgttgccgctcccgcgccgctacgaagcgcagggtgtgaggcgctatgggttc
catggattgtcgtatgcgtttctgatggaagagctggcccgcttggcgggagctgaagcg
gcgcacgggcgggtcatcctcgcccacctcggcaatggcgcgagcttggctgcgataggg
ggtggaaaatgcgtggacacgagtatggcttttaccccgactgcagggataccgatgagc
actcgctcgggcgatctggatccggggctgtttggctatctggcgcgcagcgagaatatg
agtgcgacgcaatttaacgagatggtcaattttcagtctggtctgctcggtgtatcagag
accagttctgatatgcgtgacctgttggcgtgcgaagggcgggatgtacgtgcggcggaa
gcgattgacctgttttgctaccaggtaaagaaatacattggtgcctacgcagcggtgttg
ggcggtttggataccttggtgttcgctggtggtattggcgaaaacgcgtcgcttgtccgg
caacgggtttgcgacggattaggctttctcggcatcgaactcaaccatgagcgaaacgca
gagagctcagcgctgatttcagcggacaatggcctcgtcgaagtgcgagtcatccacacc
aacgaggcattgatgattgccaaatctgttgtccatgtcctatcaacgaaggaaacatag

DBGET integrated database retrieval system